FOXA2 (NM_021784) Human Tagged ORF Clone

CAT#: RC204066

FOXA2 (Myc-DDK-tagged)-Human forkhead box A2 (FOXA2), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXA2 (NM_021784) Human Tagged ORF Clone
Symbol FOXA2
Synonyms HNF3B; TCF3B
Vector pCMV6-Entry
Sequence Data
>RC204066 representing NM_021784
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGAGCGGTGAAGATGGAAGGGCACGAGCCGTCCGACTGGAGCAGCTACTATGCAGAGCCCGAGG
GCTACTCCTCCGTGAGCAACATGAACGCCGGCCTGGGGATGAACGGCATGAACACGTACATGAGCATGTC
GGCGGCCGCCATGGGCAGCGGCTCGGGCAACATGAGCGCGGGCTCCATGAACATGTCGTCGTACGTGGGC
GCTGGCATGAGCCCGTCCCTGGCGGGGATGTCCCCCGGCGCGGGCGCCATGGCGGGCATGGGCGGCTCGG
CCGGGGCGGCTGGCGTGGCGGGCATGGGGCCGCACTTGAGTCCCAGCCTGAGCCCGCTCGGGGGGCAGGC
GGCCGGGGCCATGGGCGGCCTGGCCCCCTACGCCAACATGAACTCCATGAGCCCCATGTACGGGCAGGCG
GGCCTGAGCCGCGCCCGCGACCCCAAGACCTACAGGCGCAGCTACACGCACGCAAAGCCGCCCTACTCGT
ACATCTCGCTCATCACCATGGCCATCCAGCAGAGCCCCAACAAGATGCTGACGCTGAGCGAGATCTACCA
GTGGATCATGGACCTCTTCCCCTTCTACCGGCAGAACCAGCAGCGCTGGCAGAACTCCATCCGCCACTCG
CTCTCCTTCAACGACTGTTTCCTGAAGGTGCCCCGCTCGCCCGACAAGCCCGGCAAGGGCTCCTTCTGGA
CCCTGCACCCTGACTCGGGCAACATGTTCGAGAACGGCTGCTACCTGCGCCGCCAGAAGCGCTTCAAGTG
CGAGAAGCAGCTGGCGCTGAAGGAGGCCGCAGGCGCCGCCGGCAGCGGCAAGAAGGCGGCCGCCGGGGCC
CAGGCCTCACAGGCTCAACTCGGGGAGGCCGCCGGGCCGGCCTCCGAGACTCCGGCGGGCACCGAGTCGC
CTCACTCGAGCGCCTCCCCGTGCCAGGAGCACAAGCGAGGGGGCCTGGGAGAGCTGAAGGGGACGCCGGC
TGCGGCGCTGAGCCCCCCAGAGCCGGCGCCCTCTCCCGGGCAGCAGCAGCAGGCCGCGGCCCACCTGCTG
GGCCCGCCCCACCACCCGGGCCTGCCGCCTGAGGCCCACCTGAAGCCGGAACACCACTACGCCTTCAACC
ACCCGTTCTCCATCAACAACCTCATGTCCTCGGAGCAGCAGCACCACCACAGCCACCACCACCACCAGCC
CCACAAAATGGACCTCAAGGCCTACGAACAGGTGATGCACTACCCCGGCTACGGTTCCCCCATGCCTGGC
AGCTTGGCCATGGGCCCGGTCACGAACAAAACGGGCCTGGACGCCTCGCCCCTGGCCGCAGATACCTCCT
ACTACCAGGGGGTGTACTCCCGGCCCATTATGAACTCCTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204066 representing NM_021784
Red=Cloning site Green=Tags(s)

MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVG
AGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQA
GLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHS
LSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGA
QASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLL
GPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG
SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021784
ORF Size 1371 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021784.1, NM_021784.2, NM_021784.3, NP_068556
RefSeq Size 2242
RefSeq ORF 1392
Locus ID 3170
Cytogenetics 20p11.21
Protein Families ES Cell Differentiation/IPS, Embryonic stem cells, Induced pluripotent stem cells, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
MW 48.1 kDa
Gene Summary This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)