HNRPDL (HNRNPDL) (NM_031372) Human Tagged ORF Clone

CAT#: RC204064

Reviews ()
Write a review

HNRPDL (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein D-like (HNRPDL), transcript variant 2



  "NM_031372" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "HNRNPDL"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HNRNPDL
Synonyms HNRNP; HNRPDL; JKTBP; JKTBP2; laAUF1; LGMD1G; LGMDD3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204064 representing NM_031372
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTCCCGCCCAGGCTTTCCCATGTGCCGCCGCCATTGTTCCCCTCCGCTCCCGCTACTTTAGCCT
CCCGCAGCCTCTCCCATTGGCGGCCGCGGCCGCCGCGGCAGCTAGCCCCGCTCCTCCCTTCGCTCGCTCC
CAGCTCCGCCCGGCAGGGGGCGCGCCGGGCCCAGCGCCACGTCACCGCCCAGCAGCCCTCCCGATTGGCG
GGCGGGGCGGCTATAAAGGGAGGGCGCAGGCGGCGCCCGGATCTCTTCCGCCGCCATTTTAAATCCAGCT
CCATACAACGCTCCGCCGCCGCTGCTGCCGCGACCCGGACTGCGCGCCAGCACCCCCCTGCCGACAGCTC
CGTCACTATGGAGGATATGAACGAGTACAGCAATATAGAGGAATTCGCAGAGGGATCCAAGATCAACGCG
AGCAAGAATCAGCAGGATGACGGTAAAATGTTTATTGGAGGCTTGAGCTGGGATACAAGCAAAAAAGATC
TGACAGAGTACTTGTCTCGATTTGGGGAAGTTGTAGACTGCACAATTAAAACAGATCCAGTCACTGGGAG
ATCAAGAGGATTTGGATTTGTGCTTTTCAAAGATGCTGCTAGTGTTGATAAGGTTTTGGAACTGAAAGAA
CACAAACTGGATGGCAAATTGATAGATCCCAAAAGGGCCAAAGCTTTAAAAGGGAAAGAACCTCCCAAAA
AGGTTTTTGTGGGTGGATTGAGCCCGGATACTTCTGAAGAACAAATTAAAGAATATTTTGGAGCCTTTGG
AGAGATTGAAAATATTGAACTTCCCATGGATACAAAAACAAATGAAAGAAGAGGATTTTGTTTTATCACA
TATACTGATGAAGAGCCAGTAAAAAAATTGTTAGAAAGCAGATACCATCAAATTGGTTCTGGGAAGTGTG
AAATCAAAGTTGCACAACCCAAAGAGGTATATAGGCAGCAACAGCAACAACAAAAAGGTGGAAGAGGTGC
TGCAGCTGGTGGACGAGGTGGTACGAGGGGTCGTGGCCGAGGTCAGGGCCAAAACTGGAACCAAGGATTT
AATAACTATTATGATCAAGGATATGGAAATTACAATAGTGCCTATGGTGGTGATCAAAACTATAGTGGCT
ATGGCGGATATGATTATACTGGGTATAACTATGGGAACTATGGATATGGACAGGGATATGCAGACTACAG
TGGCCAACAGAGCACTTATGGCAAGGCATCTCGAGGGGGTGGCAATCACCAAAACAATTACCAGCCATAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC204064 representing NM_031372
Red=Cloning site Green=Tags(s)

MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLA
GGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINA
SKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE
HKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFIT
YTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGF
NNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031372
ORF Size 1260 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031372.3
RefSeq Size 3510 bp
RefSeq ORF 1263 bp
Locus ID 9987
UniProt ID O14979
Cytogenetics 4q21.22
Domains RRM
MW 46.3 kDa
Gene Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Three alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein isoforms encoded by this gene are similar to its family member HNRPD. [provided by RefSeq, May 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.