BUD23 (NM_017528) Human Tagged ORF Clone

CAT#: RC204043

WBSCR22 (Myc-DDK-tagged)-Human Williams Beuren syndrome chromosome region 22 (WBSCR22), transcript variant 2

 Cited in 1 publication.

  View "NM_017528" in other vectors (7)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BUD23 (NM_017528) Human Tagged ORF Clone
Symbol BUD23
Synonyms HASJ4442; HUSSY-3; MERM1; PP3381; WBMT
Vector pCMV6-Entry
Sequence Data
>RC204043 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCCGCGGCCGGCGTCCGGAGCATGGCGGACCCCCAGAGCTGTTTTATGACGAGACAGAAGCCC
GGAAATACGTTCGCAACTCACGGATGATTGATATCCAGACCAGGATGGCTGGGCGAGCATTGGAGCTTCT
TTATCTGCCAGAGAATAAGCCCTGTTACCTGCTGGATATTGGCTGTGGCACTGGGCTGAGTGGAAGTTAT
CTGTCAGATGAAGGGCACTATTGGGTGGGCCTGGATATCAGCCCTGCCATGCTGGATGAGGCTGTGGACC
GAGAGATAGAGGGAGACCTGCTGCTGGGGGATATGGGCCAGGGCATCCCATTCAAGCCAGGCACATTTGA
TGGTTGCATCAGCATTTCTGCTGTGCAGTGGCTCTGTAATGCTAACAAGAAGTCTGAAAACCCTGCCAAG
CGCCTGTACTGCTTTTTTGCTTCTCTTTTTTCTGTTCTCGTCCGGGGATCCCGAGCTGTCCTGCAGCTGT
ACCCTGAGAACTCAGAGCAGTTGGAGCTGATCACAACCCAGGCCACAAAGGCAGGCTTCTCCGGTGGCAT
GGTGGTAGACTACCCTAACAGTGCCAAAGCAAAGAAATTCTACCTCTGCTTGTTTTCTGGGCCTTCGACC
TTTATACCAGAGGGGCTGAGTGAAAATCAGGATGAAGTTGAACCCAGGGAGTCTGTGTTCACCAATGAGA
GGTTCCCATTAAGGATGTCGAGGCGGGGAATGGTGAGGAAGAGTCGGGCATGGGTGCTGGAGAAGAAGGA
GCGGCACAGGCGCCAGGGCAGGGAAGTCAGACCTGACACCCAGTACACCGGCCGCAAGCGCAAGCCCCGC
TTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204043 protein sequence
Red=Cloning site Green=Tags(s)

MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSY
LSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAK
RLYCFFASLFSVLVRGSRAVLQLYPENSEQLELITTQATKAGFSGGMVVDYPNSAKAKKFYLCLFSGPST
FIPEGLSENQDEVEPRESVFTNERFPLRMSRRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKPR
F

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017528
ORF Size 846 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017528.2, NM_017528.3, NM_017528.4, NP_059998
RefSeq Size 1256
RefSeq ORF 846
Locus ID 114049
Cytogenetics 7q11.23
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Histidine metabolism, Tyrosine metabolism, Selenoamino acid metabolism
MW 31.9 kDa
Gene Summary This gene encodes a protein containing a nuclear localization signal and an S-adenosyl-L-methionine binding motif typical of methyltransferases, suggesting that the encoded protein may act on DNA methylation. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been found. [provided by RefSeq, Feb 2011]

Citations (1)

Other Versions

Other products for "BUD23"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
    • 100 ul

USD 415.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones