RAB3A (NM_002866) Human Tagged ORF Clone

CAT#: RC203973

RAB3A (Myc-DDK-tagged)-Human RAB3A, member RAS oncogene family (RAB3A)

Product Images

Circular map for RC203973

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY RAB3A (Cat# RC203973, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RAB3A (Cat# TA809483)(1:2000). Positive lysates LY419059 (100ug) and LC419059 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY419059) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203973 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RAB3A protein (Cat# TP303973). The protein was produced from HEK293T cells transfected with RAB3A cDNA clone (Cat# RC203973) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RAB3A
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203973 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCATCCGCCACAGACTCGCGCTATGGGCAGAAGGAGTCCTCGGATCAGAACTTCGACTACATGTTCA
  AGATTCTCATCATCGGCAACAGCAGCGTGGGCAAGACGTCCTTCCTCTTCCGCTATGCTGACGACTCGTT
  CACGCCTGCCTTCGTCAGCACCGTGGGCATCGACTTCAAGGTCAAGACCATCTATCGCAACGACAAGAGG
  ATCAAGCTGCAGATCTGGGACACAGCAGGGCAAGAGCGGTACCGGACCATCACCACCGCATACTACCGGG
  GCGCTATGGGCTTCATCCTCATGTATGACATCACCAACGAGGAATCCTTCAATGCAGTGCAGGACTGGTC
  CACCCAGATCAAGACCTACTCATGGGACAATGCCCAGGTGCTGCTGGTAGGAAACAAGTGTGACATGGAG
  GATGAGCGGGTGGTGTCATCAGAACGTGGCCGGCAGCTAGCTGACCACCTTGGGTTCGAGTTCTTTGAGG
  CAAGCGCCAAGGACAACATTAACGTCAAGCAGACCTTTGAGCGCCTGGTGGATGTCATCTGCGAGAAGAT
  GTCCGAGTCGTTGGACACGGCGGACCCTGCGGTCACAGGCGCCAAGCAGGGCCCACAGCTCAGTGACCAG
  CAGGTGCCACCGCACCAGGACTGCGCCTGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203973 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR
  IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME
  DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ
  QVPPHQDCAC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002866
• ORF Size: 660 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002866.5
• RefSeq Size: 1528 bp
• RefSeq ORF: 663 bp
• Locus ID: 5864
• UniProt ID: P20336
• Cytogenetics: 19p13.11
• Domains: ras, RAN, RAS, RHO, RAB
• Protein Families: Druggable Genome
• MW: 25 kDa
• Gene Summary: Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane (By similarity). Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane (By similarity). Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed (By similarity). Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells (By similarity). Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9 (PubMed:27325790). Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1 (PubMed:22248876, PubMed:30599141). Plays also a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT (By similarity).[UniProtKB/Swiss-Prot Function]