beta IV Tubulin (TUBB4A) (NM_006087) Human Tagged ORF Clone

CAT#: RC203945

Reviews ()
Write a review

TUBB4A (Myc-DDK-tagged)-Human tubulin, beta 4 (TUBB4)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TUBB4A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TUBB4A
Synonyms beta-5; DYT4; TUBB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203945 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGGAGATCGTGCACCTGCAGGCCGGCCAGTGCGGCAACCAGATCGGGGCCAAGTTTTGGGAGGTTA
TCAGTGACGAACATGGCATCGACCCCACAGGCACATACCATGGGGACAGTGACCTGCAACTGGAGAGGAT
CAACGTGTACTACAACGAGGCCACAGGAGGAAATTATGTCCCCAGAGCGGTGCTGGTGGACCTGGAACCC
GGCACCATGGACTCTGTCCGTTCTGGCCCCTTCGGTCAGATCTTTCGGCCGGACAACTTCGTGTTTGGCC
AATCCGGAGCCGGCAACAACTGGGCAAAGGGGCACTACACGGAGGGCGCAGAGCTGGTGGACGCTGTCCT
GGACGTAGTCCGGAAGGAGGCCGAGAGCTGCGACTGCCTTCAGGGCTTCCAGCTGACCCACTCGCTGGGG
GGTGGCACGGGGTCCGGAATGGGCACGCTGCTCATCAGTAAGATCCGCGAGGAGTTCCCAGACCGCATCA
TGAACACCTTCAGCGTGGTGCCCTCGCCCAAAGTGTCAGACACGGTGGTGGAGCCCTACAACGCCACGCT
GTCTGTGCACCAGCTGGTGGAGAATACGGATGAGACCTACTGCATCGACAACGAGGCACTCTACGACATC
TGTTTCCGCACCCTCAAGCTGACCACCCCCACCTACGGGGACCTCAACCACCTGGTGTCGGCCACCATGA
GCGGGGTCACCACCTGCCTGCGCTTCCCGGGCCAGCTGAACGCCGACCTGCGCAAGCTGGCCGTCAACAT
GGTTCCCTTTCCTCGCCTGCACTTCTTCATGCCCGGCTTCGCACCCCTGACCAGCCGGGGCAGCCAGCAG
TACCGGGCCCTGACGGTGCCCGAGCTCACCCAGCAGATGTTCGATGCCAAGAACATGATGGCGGCGTGCG
ACCCGCGCCACGGCCGCTACCTGACCGTGGCCGCCGTGTTCCGGGGCCGCATGTCCATGAAGGAGGTGGA
CGAGCAGATGCTGAGCGTGCAGAGCAAGAACAGCAGCTACTTCGTGGAGTGGATCCCCAACAACGTGAAG
ACGGCCGTGTGCGACATCCCGCCCCGCGGCCTGAAGATGGCCGCGACCTTCATCGGCAACAGCACGGCCA
TCCAGGAGCTGTTCAAGCGCATCTCCGAGCAGTTCACGGCCATGTTCCGGCGCAAGGCCTTCTTGCACTG
GTACACGGGCGAGGGCATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAATGACCTGGTATCT
GAGTACCAGCAGTACCAGGACGCCACGGCCGAGGAGGGCGAGTTCGAGGAGGAGGCGGAGGAGGAGGTGG
CC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203945 protein sequence
Red=Cloning site Green=Tags(s)

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEP
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLG
GGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVK
TAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006087
ORF Size 1332 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006087.4
RefSeq Size 2583 bp
RefSeq ORF 1335 bp
Locus ID 10382
UniProt ID P04350
Cytogenetics 19p13.3
Domains tubulin
Protein Families Druggable Genome
Protein Pathways Gap junction, Pathogenic Escherichia coli infection
MW 49.6 kDa
Gene Summary This gene encodes a member of the beta tubulin family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene cause hypomyelinating leukodystrophy-6 and autosomal dominant torsion dystonia-4. Alternate splicing results in multiple transcript variants encoding different isoforms. A pseudogene of this gene is found on chromosome X. [provided by RefSeq, Jan 2014]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.