CALCOCO2 (NM_005831) Human Tagged ORF Clone

CAT#: RC203843

Reviews ()
Write a review

CALCOCO2 (Myc-DDK-tagged)-Human calcium binding and coiled-coil domain 2 (CALCOCO2)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CALCOCO2
Synonyms NDP52
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203843 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCA
TCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCA
TTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTAC
ACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCA
AAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCG
GGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGA
GAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTA
TCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCT
ACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTT
CAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTC
AGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCA
GTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAG
AAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAA
TGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACA
GAAAGAGAGATTGGAAGGAGAAAATGATCTTTTGAAGAGGGAGAACAGCAGATTGCTCAGTTACATGGGT
CTGGATTTTAATTCTTTGCCGTATCAAGTACCTACTTCAGATGAAGGAGGCGCAAGACAAAATCCAGGAC
TTGCCTATGGAAACCCATATTCTGGTATCCAAGAAAGTTCTTCCCCCAGCCCGCTCTCCATCAAGAAATG
CCCTATCTGCAAAGCAGATGATATTTGTGATCACACCTTGGAGCAACAGCAGATGCAGCCCCTTTGTTTC
AATTGTCCAATTTGTGACAAGATCTTCCCAGCTACAGAGAAGCAGATCTTTGAAGACCACGTGTTCTGCC
ACTCTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203843 protein sequence
Red=Cloning site Green=Tags(s)

MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY
TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG
EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL
QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK
KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG
LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
NCPICDKIFPATEKQIFEDHVFCHSL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005831
ORF Size 1338 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005831.5
RefSeq Size 3682 bp
RefSeq ORF 1341 bp
Locus ID 10241
UniProt ID Q13137
Cytogenetics 17q21.32
MW 52.3 kDa
Gene Summary This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Other products for "CALCOCO2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.