PYK2 (PTK2B) (NM_004103) Human Tagged ORF Clone

CAT#: RC203808

Reviews ()
Write a review

PTK2B (Myc-DDK-tagged)-Human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2



  "NM_004103" in other vectors (8)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 878.00

USD 1,317.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PTK2B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PTK2B
Synonyms CADTK; CAKB; FADK2; FAK2; PKB; PTK; PYK2; RAFTK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203808 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGGGTGTCCGAGCCCCTGAGTCGAGTAAAGTTGGGCACGTTACGCCGGCCTGAAGGCCCTGCAG
AGCCCATGGTGGTGGTACCAGTAGATGTGGAAAAGGAGGACGTGCGTATCCTCAAGGTCTGCTTCTATAG
CAACAGCTTCAATCCTGGGAAAAACTTCAAACTGGTCAAATGCACTGTCCAGACGGAGATCCGGGAGATC
ATCACCTCCATCCTGCTGAGCGGGCGGATCGGGCCCAACATCCGGTTGGCTGAGTGCTATGGGCTGAGGC
TGAAGCACATGAAGTCCGATGAGATCCACTGGCTGCACCCACAGATGACAGTGGGTGAGGTGCAGGACAA
GTATGAGTGTCTGCACGTGGAAGCCGAGTGGAGGTATGACCTTCAAATCCGCTACTTGCCAGAAGACTTC
ATGGAGAGCCTGAAGGAGGACAGGACCACGCTGCTCTATTTTTACCAACAGCTCCGGAACGACTACATGC
AGCGCTACGCCAGCAAGGTCAGCGAGGGCATGGCCCTGCAGCTGGGCTGCCTGGAGCTCAGGCGGTTCTT
CAAGGATATGCCCCACAATGCACTTGACAAGAAGTCCAACTTCGAGCTCCTAGAAAAGGAAGTGGGGCTG
GACTTGTTTTTCCCAAAGCAGATGCAGGAGAACTTAAAGCCCAAACAGTTCCGGAAGATGATCCAGCAGA
CCTTCCAGCAGTACGCCTCGCTCAGGGAGGAGGAGTGCGTCATGAAGTTCTTCAACACTCTCGCCGGCTT
CGCCAACATCGACCAGGAGACCTACCGCTGTGAACTCATTCAAGGATGGAACATTACTGTGGACCTGGTC
ATTGGCCCTAAAGGGATCCGCCAGCTGACTAGTCAGGACGCAAAGCCCACCTGCCTGGCCGAGTTCAAGC
AGATCAGGTCCATCAGGTGCCTCCCGCTGGAGGAGGGCCAGGCAGTACTTCAGCTGGGCATTGAAGGTGC
CCCCCAGGCCTTGTCCATCAAAACCTCATCCCTAGCAGAGGCTGAGAACATGGCTGACCTCATAGACGGC
TACTGCCGGCTGCAGGGTGAGCACCAAGGCTCTCTCATCATCCATCCTAGGAAAGATGGTGAGAAGCGGA
ACAGCCTGCCCCAGATCCCCATGCTAAACCTGGAGGCCCGGCGGTCCCACCTCTCAGAGAGCTGCAGCAT
AGAGTCAGACATCTACGCAGAGATTCCCGACGAAACCCTGCGAAGGCCCGGAGGTCCACAGTATGGCATT
GCCCGTGAAGATGTGGTCCTGAATCGTATTCTTGGGGAAGGCTTTTTTGGGGAGGTCTATGAAGGTGTCT
ACACAAATCATAAAGGGGAGAAAATCAATGTAGCTGTCAAGACCTGCAAGAAAGACTGCACTCTGGACAA
CAAGGAGAAGTTCATGAGCGAGGCAGTGATCATGAAGAACCTCGACCACCCGCACATCGTGAAGCTGATC
GGCATCATTGAAGAGGAGCCCACCTGGATCATCATGGAATTGTATCCCTATGGGGAGCTGGGCCACTACC
TGGAGCGGAACAAGAACTCCCTGAAGGTGCTCACCCTCGTGCTGTACTCACTGCAGATATGCAAAGCCAT
GGCCTACCTGGAGAGCATCAACTGCGTGCACAGGGACATTGCTGTCCGGAACATCCTGGTGGCCTCCCCT
GAGTGTGTGAAGCTGGGGGACTTTGGTCTTTCCCGGTACATTGAGGACGAGGACTATTACAAAGCCTCTG
TGACTCGTCTCCCCATCAAATGGATGTCCCCAGAGTCCATTAACTTCCGACGCTTCACGACAGCCAGTGA
CGTCTGGATGTTCGCCGTGTGCATGTGGGAGATCCTGAGCTTTGGGAAGCAGCCCTTCTTCTGGCTGGAG
AACAAGGATGTCATCGGGGTGCTGGAGAAAGGAGACCGGCTGCCCAAGCCTGATCTCTGTCCACCGGTCC
TTTATACCCTCATGACCCGCTGCTGGGACTACGACCCCAGTGACCGGCCCCGCTTCACCGAGCTGGTGTG
CAGCCTCAGTGACGTTTATCAGATGGAGAAGGACATTGCCATGGAGCAAGAGAGGAATGCTCGCTACCGA
ACCCCCAAAATCTTGGAGCCCACAGCCTTCCAGGAACCCCCACCCAAGCCCAGCCGACCTAAGTACAGAC
CCCCTCCGCAAACCAACCTCCTGGCTCCAAAGCTGCAGTTCCAGGTTCCTGAGGGTCTGTGTGCCAGCTC
TCCTACGCTCACCAGCCCTATGGAGTATCCATCTCCCGTTAACTCACTGCACACCCCACCTCTCCACCGG
CACAATGTCTTCAAACGCCACAGCATGCGGGAGGAGGACTTCATCCAACCCAGCAGCCGAGAAGAGGCCC
AGCAGCTGTGGGAGGCTGAAAAGGTCAAAATGCGGCAAATCCTGGACAAACAGCAGAAGCAGATGGTGGA
GGACTACCAGTGGCTCAGGCAGGAGGAGAAGTCCCTGGACCCCATGGTTTATATGAATGATAAGTCCCCA
TTGACGCCAGAGAAGGAGGTCGGCTACCTGGAGTTCACAGGGCCCCCACAGAAGCCCCCGAGGCTGGGCG
CACAGTCCATCCAGCCCACAGCTAACCTGGACCGGACCGATGACCTGGTGTACCTCAATGTCATGGAGCT
GGTGCGGGCCGTGCTGGAGCTCAAGAATGAGCTCTGTCAGCTGCCCCCCGAGGGCTACGTGGTGGTGGTG
AAGAATGTGGGGCTGACCCTGCGGAAGCTCATCGGGAGCGTGGATGATCTCCTGCCTTCCTTGCCGTCAT
CTTCACGGACAGAGATCGAGGGCACCCAGAAACTGCTCAACAAAGACCTGGCAGAGCTCATCAACAAGAT
GCGGCTGGCGCAGCAGAACGCCGTGACCTCCCTGAGTGAGGAGTGCAAGAGGCAGATGCTGACGGCTTCA
CACACCCTGGCTGTGGACGCCAAGAACCTGCTCGACGCTGTGGACCAGGCCAAGGTTCTGGCCAATCTGG
CCCACCCACCTGCAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203808 protein sequence
Red=Cloning site Green=Tags(s)

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI
ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF
MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL
DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV
IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG
YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI
GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP
ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE
NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR
TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHR
HNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVV
KNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTAS
HTLAVDAKNLLDAVDQAKVLANLAHPPAE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004103
ORF Size 3027 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004103.4
RefSeq Size 4193 bp
RefSeq ORF 3030 bp
Locus ID 2185
UniProt ID Q14289
Cytogenetics 8p21.2
Domains B41, pkinase, TyrKc, S_TKc, Focal_AT
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, Chemokine signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity
MW 115.9 kDa
Gene Summary This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.