HSD17B8 (NM_014234) Human Tagged ORF Clone

CAT#: RC203806

HSD17B8 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 8 (HSD17B8)



  "NM_014234" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "HSD17B8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HSD17B8
Synonyms D6S2245E; dJ1033B10.9; FABG; FABGL; H2-KE6; HKE6; KE6; RING2; SDR30C1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203806 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCTCAGCTCCAGAACCGACTCCGCTCCGCACTGGCCTTGGTCACAGGTGCGGGGAGCGGCATCG
GCCGAGCGGTCAGTGTACGCCTGGCCGGAGAGGGGGCCACCGTAGCTGCCTGCGACCTGGACCGGGCAGC
GGCACAGGAGACGGTGCGGCTGCTGGGCGGGCCAGGGAGCAAGGAGGGGCCGCCCCGAGGGAACCATGCT
GCCTTCCAGGCTGACGTGTCTGAGGCCAGGGCCGCCAGGTGCCTGCTGGAACAAGTGCAGGCCTGCTTTT
CTCGCCCACCATCTGTCGTTGTGTCCTGTGCGGGCATCACCCAGGATGAGTTTCTGCTGCACATGTCTGA
GGATGACTGGGACAAAGTCATAGCTGTCAACCTCAAGGGCACCTTCCTAGTCACTCAGGCTGCAGCACAA
GCCCTGGTGTCCAATGGTTGTCGTGGTTCCATCATCAACATCAGTAGCATCGTAGGAAAGGTGGGGAACG
TGGGGCAGACAAACTATGCAGCATCCAAGGCTGGAGTGATTGGGCTGACCCAGACCGCAGCCCGGGAGCT
TGGACGACATGGGATCCGCTGTAACTCTGTCCTCCCAGGGTTCATTGCAACACCCATGACACAGAAAGTG
CCACAGAAAGTGGTGGACAAGATTACTGAAATGATCCCGATGGGACACTTGGGGGACCCTGAGGATGTGG
CAGATGTGGTCGCATTCTTGGCATCTGAAGATAGTGGATACATCACAGGGACCTCAGTGGAAGTCACTGG
AGGTCTTTTCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203806 protein sequence
Red=Cloning site Green=Tags(s)

MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHA
AFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQ
ALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV
PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014234
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014234.5
RefSeq Size 1002 bp
RefSeq ORF 786 bp
Locus ID 7923
UniProt ID Q92506
Cytogenetics 6p21.32
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Metabolic pathways
MW 27 kDa
Gene Summary In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.