OLFM2 (NM_058164) Human Tagged ORF Clone

CAT#: RC203786

Reviews ()
Write a review

OLFM2 (Myc-DDK-tagged)-Human olfactomedin 2 (OLFM2)



  "NM_058164" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "OLFM2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OLFM2
Synonyms NOE2; NOELIN2; NOELIN2_V1; OlfC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203786 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCCGCTCACGGTCCCGCCGCCGCTGCTGCTGCTGCTGTGCTCAGGCCTGGCCGGACAGACTCTCT
TCCAGAACCCAGAAGAGGGCTGGCAGCTGTACACCTCAGCCCAGGCCCCTGACGGGAAATGCATCTGCAC
GGCCGTGATCCCAGCGCAGAGTACCTGCTCTCGAGATGGCAGGAGTCGGGAGCTGCGGCAACTGATGGAG
AAGGTCCAGAACGTCTCCCAGTCCATGGAGGTCCTTGAGTTGCGGACGTATCGCGACCTCCAGTATGTAC
GCGGCATGGAGACCCTCATGCGGAGCCTGGATGCGCGGCTCCGGGCAGCTGATGGGTCCCTCTCGGCCAA
GAGCTTCCAGGAGCTGAAGGACAGGATGACGGAACTGTTGCCCCTGAGCTCGGTCCTGGAGCAGTACAAG
GCAGACACGCGGACCATTGTACGCTTGCGGGAGGAGGTGAGGAATCTCTCCGGCAGTCTGGCGGCCATTC
AGGAGGAGATGGGTGCCTACGGGTATGAGGACCTGCAGCAACGGGTGATGGCCCTGGAGGCCCGGCTCCA
CGCCTGCGCCCAGAAGCTGGGCTGTGGGAAGCTGACCGGGGTCAGTAACCCCATCACCGTTCGGGCCATG
GGGTCCCGCTTCGGCTCCTGGATGACTGACACGATGGCCCCCAGTGCGGATAGCCGGGTCTGGTACATGG
ATGGCTATTACAAAGGCCGCCGGGTCCTGGAGTTCCGTACCCTGGGAGACTTCATCAAAGGCCAGAACTT
TATCCAGCACCTGCTGCCCCAGCCGTGGGCGGGCACGGGCCACGTGGTGTACAACGGCTCCCTGTTCTAT
AACAAGTACCAGAGCAACGTGGTGGTCAAATACCACTTCCGCTCGCGCTCTGTGCTGGTGCAGAGGAGCC
TCCCGGGCGCCGGTTACAACAACACCTTCCCCTACTCCTGGGGCGGCTTCTCCGACATGGACTTCATGGT
GGACGAGAGCGGGCTCTGGGCTGTGTACACCACCAACCAGAACGCGGGCAACATCGTGGTCAGCCGGCTG
GACCCGCACACCCTCGAGGTCATGCGGTCCTGGGACACCGGCTACCCCAAGCGCAGCGCTGGCGAGGCCT
TCATGATCTGCGGTGTGCTCTACGTGACCAACTCCCACCTGGCTGGGGCCAAGGTCTACTTCGCCTATTT
TACCAACACGTCCAGTTACGAGTACACGGACGTGCCCTTCCACAACCAGTATTCCCACATCTCGATGCTG
GATTACAACCCCCGGGAGCGCGCCCTCTATACCTGGAACAACGGCCACCAGGTGCTCTACAATGTCACCC
TGTTTCACGTCATCAGCACCTCTGGGGACCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203786 protein sequence
Red=Cloning site Green=Tags(s)

MWPLTVPPPLLLLLCSGLAGQTLFQNPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDGRSRELRQLME
KVQNVSQSMEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQELKDRMTELLPLSSVLEQYK
ADTRTIVRLREEVRNLSGSLAAIQEEMGAYGYEDLQQRVMALEARLHACAQKLGCGKLTGVSNPITVRAM
GSRFGSWMTDTMAPSADSRVWYMDGYYKGRRVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFY
NKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRL
DPHTLEVMRSWDTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISML
DYNPRERALYTWNNGHQVLYNVTLFHVISTSGDP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_058164
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_058164.4
RefSeq Size 1899 bp
RefSeq ORF 1365 bp
Locus ID 93145
UniProt ID O95897
Cytogenetics 19p13.2
Domains OLF
Protein Families Druggable Genome, Secreted Protein
MW 51.4 kDa
Gene Summary Involved in transforming growth factor beta (TGF-beta)-induced smooth muscle differentiation. TGF-beta induces expression and translocation of OLFM2 to the nucleus where it binds to SRF, causing its dissociation from the transcriptional repressor HEY2/HERP1 and facilitating binding of SRF to target genes (PubMed:25298399). Plays a role in AMPAR complex organization (By similarity). Is a regulator of vascular smooth-muscle cell (SMC) phenotypic switching, that acts by promoting RUNX2 and inhibiting MYOCD binding to SRF. SMC phenotypic switching is the process through which vascular SMCs undergo transition between a quiescent contractile phenotype and a proliferative synthetic phenotype in response to pathological stimuli. SMC phenotypic plasticity is essential for vascular development and remodeling (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.