ALIX (PDCD6IP) (NM_013374) Human Tagged ORF Clone

CAT#: RC203735

Reviews ()
Write a review

PDCD6IP (Myc-DDK-tagged)-Human programmed cell death 6 interacting protein (PDCD6IP), transcript variant 1



  "NM_013374" in other vectors (7)

Reconstitution Protocol

USD 795.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PDCD6IP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDCD6IP
Synonyms AIP1; ALIX; DRIP4; HP95
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203735 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACATTCATCTCGGTGCAGCTGAAAAAGACCTCAGAGGTGGACCTGGCCAAGCCGCTGGTGAAGT
TCATCCAGCAGACTTACCCAAGCGGCGGGGAAGAGCAGGCCCAGTACTGCCGCGCGGCGGAGGAGCTCAG
CAAGCTGCGCCGCGCCGCAGTCGGTCGTCCGCTGGACAAGCACGAGGGCGCGCTCGAGACGCTCCTGAGA
TATTATGATCAGATTTGTTCTATTGAACCCAAATTCCCATTTTCTGAAAATCAGATCTGCTTGACATTTA
CCTGGAAGGATGCTTTCGATAAAGGTTCACTTTTTGGAGGCTCTGTAAAACTGGCTCTTGCAAGCTTAGG
ATATGAAAAGAGCTGTGTGTTGTTCAATTGTGCAGCCTTAGCTAGCCAAATTGCAGCAGAACAGAACCTG
GATAATGATGAAGGATTGAAAATCGCTGCTAAACATTACCAGTTTGCTAGTGGTGCCTTTTTACATATTA
AAGAGACGGTTTTATCTGCCTTAAGTCGAGAGCCGACCGTGGACATATCTCCAGATACTGTTGGGACCCT
CAGTCTTATTATGCTGGCACAGGCTCAAGAAGTATTTTTTTTAAAAGCCACAAGAGATAAAATGAAAGAT
GCCATCATAGCTAAATTGGCTAATCAGGCTGCAGATTATTTTGGTGATGCTTTCAAACAGTGTCAATACA
AAGATACTCTCCCCAAGGAGGTGTTCCCTGTCTTGGCTGCAAAGCACTGTATCATGCAGGCCAATGCTGA
GTACCATCAGTCTATCCTGGCAAAACAGCAGAAGAAATTTGGAGAAGAAATTGCAAGGTTACAGCATGCA
GCAGAACTGATTAAAACAGTGGCATCTCGCTATGATGAATATGTTAATGTGAAGGATTTTTCTGACAAAA
TCAATCGTGCCCTTGCTGCAGCAAAGAAGGATAATGACTTCATTTATCATGATCGAGTTCCAGACCTTAA
AGATCTAGATCCTATTGGCAAAGCCACACTTGTGAAATCTACCCCGGTCAATGTACCCATCAGTCAGAAA
TTTACTGATCTGTTTGAGAAGATGGTTCCCGTGTCAGTACAGCAGTCTTTGGCTGCCTATAATCAGAGGA
AAGCCGATTTGGTTAACAGATCAATTGCTCAGATGAGAGAAGCCACCACTTTGGCAAATGGGGTGCTAGC
TTCCCTTAATCTTCCAGCAGCAATTGAAGATGTGTCTGGAGACACTGTACCTCAGTCTATATTGACTAAA
TCCAGATCTGTGATTGAACAGGGAGGCATCCAGACTGTTGATCAGTTGATTAAAGAACTGCCTGAATTAC
TGCAACGAAATAGAGAAATCCTAGATGAGTCATTAAGGTTGTTGGATGAAGAAGAAGCAACCGATAATGA
TTTAAGAGCAAAATTTAAGGAACGTTGGCAAAGGACACCATCCAATGAACTGTATAAGCCTTTAAGAGCA
GAGGGAACCAACTTCAGAACAGTTTTAGATAAAGCTGTGCAGGCAGATGGACAAGTGAAAGAATGTTACC
AGTCTCATCGTGACACCATCGTGCTTTTGTGTAAGCCAGAGCCTGAGCTGAATGCTGCCATCCCTTCTGC
TAATCCAGCAAAGACCATGCAGGGCAGTGAGGTTGTAAATGTCTTAAAATCCTTATTGTCAAATCTTGAT
GAAGTAAAGAAGGAAAGAGAGGGTCTGGAGAATGACTTGAAATCTGTGAATTTTGACATGACAAGCAAGT
TTTTGACAGCCCTGGCTCAAGATGGTGTGATAAATGAAGAAGCTCTTTCTGTTACTGAACTAGATCGAGT
CTATGGAGGTCTTACAACTAAAGTCCAAGAATCTCTAAAGAAACAGGAGGGACTTCTTAAAAATATTCAG
GTCTCACATCAGGAATTTTCAAAAATGAAACAATCTAATAATGAAGCTAACTTAAGAGAAGAAGTTTTGA
AGAATTTAGCTACTGCATATGACAACTTTGTTGAACTTGTAGCTAATTTGAAGGAAGGCACAAAGTTTTA
CAATGAGTTGACTGAAATCCTGGTCAGGTTCCAGAACAAATGCAGTGATATAGTTTTTGCACGGAAGACA
GAAAGAGATGAACTCTTAAAGGACTTGCAACAAAGCATTGCCAGAGAACCTAGTGCTCCTTCAATTCCTA
CACCTGCGTATCAGTCCTCACCAGCAGGAGGACATGCACCAACTCCTCCAACTCCAGCGCCAAGAACCAT
GCCGCCTACTAAGCCCCAGCCCCCAGCCAGGCCTCCACCACCTGTGCTTCCAGCAAATCGAGCTCCTTCT
GCTACTGCTCCATCTCCAGTGGGGGCTGGGACTGCTGCGCCAGCTCCATCACAAACGCCTGGCTCAGCTC
CTCCTCCACAGGCGCAGGGACCACCCTATCCCACCTATCCAGGATATCCTGGGTATTGCCAAATGCCCAT
GCCCATGGGCTATAATCCTTATGCGTATGGCCAGTATAATATGCCATATCCACCAGTGTATCACCAGAGT
CCTGGACAGGCTCCATACCCGGGACCCCAGCAGCCTTCATACCCCTTCCCTCAGCCCCCACAGCAGTCTT
ACTATCCACAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203735 protein sequence
Red=Cloning site Green=Tags(s)

MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD
AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA
AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK
FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA
EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD
EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ
VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT
ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS
ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013374
ORF Size 2604 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013374.6
RefSeq Size 5972 bp
RefSeq ORF 2607 bp
Locus ID 10015
UniProt ID Q8WUM4
Cytogenetics 3p22.3
Domains BRO1
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 96 kDa
Gene Summary This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15. [provided by RefSeq, Jan 2012]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.