VASP (NM_003370) Human Tagged ORF Clone

CAT#: RC203544

  • TrueORF®

VASP (Myc-DDK-tagged)-Human vasodilator-stimulated phosphoprotein (VASP)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_003370" in other vectors (6)

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


VASP mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
    • 100 ul

USD 447.00

Other products for "VASP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VASP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203544 representing NM_003370
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGAGACGGTCATCTGTTCCAGCCGGGCCACTGTGATGCTTTATGATGATGGCAACAAGCGATGGC
TCCCTGCTGGCACGGGTCCCCAGGCCTTCAGCCGCGTCCAGATCTACCACAACCCCACGGCCAATTCCTT
TCGCGTCGTGGGCCGGAAGATGCAGCCCGACCAGCAGGTGGTCATCAACTGTGCCATCGTCCGGGGTGTC
AAGTATAACCAGGCCACCCCCAACTTCCATCAGTGGCGCGACGCTCGCCAGGTCTGGGGCCTCAACTTCG
GCAGCAAGGAGGATGCGGCCCAGTTTGCCGCCGGCATGGCCAGTGCCCTAGAGGCGTTGGAAGGAGGTGG
GCCCCCTCCACCCCCAGCACTTCCCACCTGGTCGGTCCCGAACGGCCCCTCCCCGGAGGAGGTGGAGCAG
CAGAAAAGGCAGCAGCCCGGCCCGTCGGAGCACATAGAGCGCCGGGTCTCCAATGCAGGAGGCCCACCTG
CTCCCCCCGCTGGGGGTCCACCCCCACCACCAGGACCTCCCCCTCCTCCAGGTCCCCCCCCACCCCCAGG
TTTGCCCCCTTCGGGGGTCCCAGCTGCAGCGCACGGAGCAGGGGGAGGACCACCCCCTGCACCCCCTCTC
CCGGCAGCACAGGGCCCTGGTGGTGGGGGAGCTGGGGCCCCAGGCCTGGCCGCAGCTATTGCTGGAGCCA
AACTCAGGAAAGTCAGCAAGCAGGAGGAGGCCTCAGGGGGGCCCACAGCCCCCAAAGCTGAGAGTGGTCG
AAGCGGAGGTGGGGGACTCATGGAAGAGATGAACGCCATGCTGGCCCGGAGAAGGAAAGCCACGCAAGTT
GGGGAGAAAACCCCCAAGGATGAATCTGCCAATCAGGAGGAGCCAGAGGCCAGAGTCCCGGCCCAGAGTG
AATCTGTGCGGAGACCCTGGGAGAAGAACAGCACAACCTTGCCAAGGATGAAGTCGTCTTCTTCGGTGAC
CACTTCCGAGACCCAACCCTGCACGCCCAGCTCCAGTGATTACTCGGACCTACAGAGGGTGAAACAGGAG
CTTCTGGAAGAGGTGAAGAAGGAATTGCAGAAAGTGAAAGAGGAAATCATTGAAGCCTTCGTCCAGGAGC
TGAGGAAGCGGGGTTCTCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203544 representing NM_003370
Red=Cloning site Green=Tags(s)

MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGV
KYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQ
QKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPL
PAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQV
GEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQE
LLEEVKKELQKVKEEIIEAFVQELRKRGSP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003370
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003370.4
RefSeq Size 2298 bp
RefSeq ORF 1143 bp
Locus ID 7408
UniProt ID P50552
Cytogenetics 19q13.32
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration
MW 40.3 kDa
Gene Summary Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.