ATP6V0D1 (NM_004691) Human Tagged ORF Clone

CAT#: RC203498

ATP6V0D1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATP6V0D1 (NM_004691) Human Tagged ORF Clone
Symbol ATP6V0D1
Synonyms ATP6D; ATP6DV; P39; VATX; VMA6; VPATPD
Vector pCMV6-Entry
Sequence Data
>RC203498 representing NM_004691
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTTCTTCCCGGAGCTTTACTTTAACGTGGACAATGGCTACTTGGAGGGACTGGTGCGCGGCCTGA
AGGCCGGGGTGCTCAGCCAGGCCGACTACCTCAACCTGGTGCAGTGCGAGACGCTAGAGGACTTGAAACT
GCATCTGCAGAGCACTGATTATGGTAACTTCCTGGCCAACGAGGCATCACCTCTGACGGTGTCAGTCATC
GATGACCGGCTCAAGGAGAAGATGGTGGTGGAGTTCCGCCACATGAGGAACCATGCCTATGAGCCACTCG
CCAGCTTCCTAGACTTCATTACTTACAGTTACATGATCGACAACGTGATCCTGCTCATCACAGGCACGCT
GCACCAGCGCTCCATCGCTGAGCTCGTGCCCAAGTGCCACCCACTAGGCAGCTTCGAGCAGATGGAGGCC
GTGAACATTGCTCAGACACCTGCTGAGCTCTACAATGCCATTCTGGTGGACACGCCTCTTGCGGCTTTTT
TCCAGGACTGCATTTCAGAGCAGGACCTTGACGAGATGAACATCGAGATCATCCGCAACACCCTCTACAA
GGCCTACCTGGAGTCCTTCTACAAGTTCTGCACCCTACTGGGCGGGACTACGGCTGATGCCATGTGCCCC
ATCCTGGAGTTTGAAGCAGACCGCCGCGCCTTCATCATCACCATCAATTCTTTCGGCACAGAGCTGTCCA
AAGAGGACCGTGCCAAGCTCTTTCCACACTGTGGGCGGCTCTACCCTGAGGGCCTGGCGCAGCTGGCTCG
GGCTGACGACTATGAACAGGTCAAGAACGTGGCCGATTACTACCCGGAGTACAAGCTGCTCTTCGAGGGT
GCAGGTAGCAACCCTGGAGACAAGACGCTGGAGGACCGATTCTTTGAGCACGAGGTAAAGCTGAACAAGT
TGGCCTTCCTGAACCAGTTCCACTTTGGTGTCTTCTATGCCTTCGTGAAGCTCAAGGAGCAGGAGTGTCG
CAACATCGTGTGGATCGCTGAATGTATCGCCCAGCGCCACCGCGCCAAAATCGACAACTACATCCCTATC
TTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203498 representing NM_004691
Red=Cloning site Green=Tags(s)

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI
DDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEA
VNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCP
ILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEG
AGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPI
F

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004691
ORF Size 1053 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004691.2, NM_004691.3, NM_004691.4, NP_004682
RefSeq Size 1688
RefSeq ORF 1056
Locus ID 9114
Cytogenetics 16q22.1
Domains vATP-synt_AC39
Protein Pathways Oxidative phosphorylation, Metabolic pathways, Lysosome, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection
MW 40.1 kDa
Gene Summary This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)