D4(ARHGDIB) (NM_001175) Human Tagged ORF Clone

CAT#: RC203496

ARHGDIB (Myc-DDK-tagged)-Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name D4(ARHGDIB) (NM_001175) Human Tagged ORF Clone
Symbol ARHGDIB
Synonyms D4; GDIA2; GDID4; Ly-GDI; LYGDI; RAP1GN1; RhoGDI2
Vector pCMV6-Entry
Sequence Data
>RC203496 representing NM_001175
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGAAAAAGCCCCAGAGCCACATGTGGAGGAGGATGACGATGATGAGCTGGACAGCAAGCTCAATT
ATAAGCCTCCACCACAGAAGTCCCTGAAAGAGCTGCAGGAAATGGACAAAGATGATGAGAGTCTAATTAA
GTACAAGAAAACGCTGCTGGGAGATGGTCCTGTGGTGACAGATCCGAAAGCCCCCAATGTCGTTGTCACC
CGGCTCACCCTGGTTTGTGAGAGTGCCCCGGGACCAATCACCATGGACCTTACTGGAGATCTGGAAGCCC
TCAAAAAGGAAACCATTGTGTTAAAGGAAGGTTCTGAATATAGAGTCAAAATTCACTTCAAAGTGAACAG
GGATATTGTGTCAGGCCTGAAATACGTTCAGCACACCTACAGGACTGGGGTGAAAGTGGATAAAGCAACA
TTTATGGTTGGCAGCTATGGACCTCGGCCTGAGGAGTATGAGTTCCTCACTCCAGTTGAGGAGGCTCCCA
AGGGCATGCTGGCCCGAGGCACGTACCACAACAAGTCCTTCTTCACCGACGATGACAAGCAAGACCACCT
CAGCTGGGAGTGGAACCTGTCGATTAAGAAGGAGTGGACAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203496 representing NM_001175
Red=Cloning site Green=Tags(s)

MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT
RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT
FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001175
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001175.1, NM_001175.2, NM_001175.3, NM_001175.4, NM_001175.5, NM_001175.6, NP_001166
RefSeq Size 1216
RefSeq ORF 606
Locus ID 397
Cytogenetics 12p12.3
Domains Rho_GDI
Protein Families Druggable Genome
Protein Pathways Neurotrophin signaling pathway
MW 22.8 kDa
Gene Summary Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)