Smoothened (SMO) (NM_005631) Human Tagged ORF Clone

USD 610.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Smoothened (SMO) (NM_005631) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SMO
Synonyms CRJS; FZD11; Gx; SMOH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC203451 representing NM_005631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCTGCCCGCCCAGCGCGGGGGCCGGAGCTCCCGCTCCTGGGGCTGCTGCTGCTGCTGCTGCTGG
GGGACCCGGGCCGGGGGGCGGCCTCGAGCGGGAACGCGACCGGGCCTGGGCCTCGGAGCGCGGGCGGGAG
CGCGAGGAGGAGCGCGGCGGTGACTGGCCCTCCGCCGCCGCTGAGCCACTGCGGCCGGGCTGCCCCCTGC
GAGCCGCTGCGCTACAACGTGTGCCTGGGCTCGGTGCTGCCCTACGGGGCCACCTCCACACTGCTGGCCG
GAGACTCGGACTCCCAGGAGGAAGCGCACGGCAAGCTCGTGCTCTGGTCGGGCCTCCGGAATGCCCCCCG
CTGCTGGGCAGTGATCCAGCCCCTGCTGTGTGCCGTATACATGCCCAAGTGTGAGAATGACCGGGTGGAG
CTGCCCAGCCGTACCCTCTGCCAGGCCACCCGAGGCCCCTGTGCCATCGTGGAGAGGGAGCGGGGCTGGC
CTGACTTCCTGCGCTGCACTCCTGACCGCTTCCCTGAAGGCTGCACGAATGAGGTGCAGAACATCAAGTT
CAACAGTTCAGGCCAGTGCGAAGTGCCCTTGGTTCGGACAGACAACCCCAAGAGCTGGTACGAGGACGTG
GAGGGCTGCGGCATCCAGTGCCAGAACCCGCTCTTCACAGAGGCTGAGCACCAGGACATGCACAGCTACA
TCGCGGCCTTCGGGGCCGTCACGGGCCTCTGCACGCTCTTCACCCTGGCCACATTCGTGGCTGACTGGCG
GAACTCGAATCGCTACCCTGCTGTTATTCTCTTCTACGTCAATGCGTGCTTCTTTGTGGGCAGCATTGGC
TGGCTGGCCCAGTTCATGGATGGTGCCCGCCGAGAGATCGTCTGCCGTGCAGATGGCACCATGAGGCTTG
GGGAGCCCACCTCCAATGAGACTCTGTCCTGCGTCATCATCTTTGTCATCGTGTACTACGCCCTGATGGC
TGGTGTGGTTTGGTTTGTGGTCCTCACCTATGCCTGGCACACTTCCTTCAAAGCCCTGGGCACCACCTAC
CAGCCTCTCTCGGGCAAGACCTCCTACTTCCACCTGCTCACCTGGTCACTCCCCTTTGTCCTCACTGTGG
CAATCCTTGCTGTGGCGCAGGTGGATGGGGACTCTGTGAGTGGCATTTGTTTTGTGGGCTACAAGAACTA
CCGATACCGTGCGGGCTTCGTGCTGGCCCCAATCGGCCTGGTGCTCATCGTGGGAGGCTACTTCCTCATC
CGAGGAGTCATGACTCTGTTCTCCATCAAGAGCAACCACCCCGGGCTGCTGAGTGAGAAGGCTGCCAGCA
AGATCAACGAGACCATGCTGCGCCTGGGCATTTTTGGCTTCCTGGCCTTTGGCTTTGTGCTCATTACCTT
CAGCTGCCACTTCTACGACTTCTTCAACCAGGCTGAGTGGGAGCGCAGCTTCCGGGACTATGTGCTATGT
CAGGCCAATGTGACCATCGGGCTGCCCACCAAGCAGCCCATCCCTGACTGTGAGATCAAGAATCGCCCGA
GCCTTCTGGTGGAGAAGATCAACCTGTTTGCCATGTTTGGAACTGGCATCGCCATGAGCACCTGGGTCTG
GACCAAGGCCACGCTGCTCATCTGGAGGCGTACCTGGTGCAGGTTGACTGGGCAGAGTGACGATGAGCCA
AAGCGGATCAAGAAGAGCAAGATGATTGCCAAGGCCTTCTCTAAGCGGCACGAGCTCCTGCAGAACCCAG
GCCAGGAGCTGTCCTTCAGCATGCACACTGTGTCCCACGACGGGCCCGTGGCGGGCTTGGCCTTTGACCT
CAATGAGCCCTCAGCTGATGTCTCCTCTGCCTGGGCCCAGCATGTCACCAAGATGGTGGCTCGGAGAGGA
GCCATACTGCCCCAGGATATTTCTGTCACCCCTGTGGCAACTCCAGTGCCCCCAGAGGAACAAGCCAACC
TGTGGCTGGTTGAGGCAGAGATCTCCCCAGAGCTGCAGAAGCGCCTGGGCCGGAAGAAGAAGAGGAGGAA
GAGGAAGAAGGAGGTGTGCCCGCTGGCGCCGCCCCCTGAGCTTCACCCCCCTGCCCCTGCCCCCAGTACC
ATTCCTCGACTGCCTCAGCTGCCCCGGCAGAAATGCCTGGTGGCTGCAGGTGCCTGGGGAGCTGGGGACT
CTTGCCGACAGGGAGCGTGGACCCTGGTCTCCAACCCATTCTGCCCAGAGCCCAGTCCCCCTCAGGATCC
ATTTCTGCCCAGTGCACCGGCCCCCGTGGCATGGGCTCATGGCCGCCGACAGGGCCTGGGGCCTATTCAC
TCCCGCACCAACCTGATGGACACAGAACTCATGGATGCAGACTCGGACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203451 representing NM_005631
Red=Cloning site Green=Tags(s)

MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPC
EPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVE
LPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDV
EGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIG
WLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTY
QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLC
QANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEP
KRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRG
AILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPST
IPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH
SRTNLMDTELMDADSDF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005631
ORF Size 2361 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005631.1, NM_005631.2, NM_005631.3, NM_005631.4, NP_005622.1
RefSeq Size 3772 bp
RefSeq ORF 2364 bp
Locus ID 6608
Cytogenetics 7q32.1
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer
MW 86.2 kDa
Gene Summary The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. [provided by RefSeq, Jul 2010]

Citations (1)

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Goat Polyclonal Antibody against SMO (Internal region)
    • 100 ug

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools