CLC7(CLCN7) (NM_001287) Human Tagged ORF Clone

CAT#: RC203450

CLCN7 (Myc-DDK-tagged)-Human chloride channel 7 (CLCN7), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CLC7(CLCN7) (NM_001287) Human Tagged ORF Clone
Symbol CLCN7
Synonyms CLC-7; CLC7; OPTA2; OPTB4; PPP1R63
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC203450 representing NM_001287
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAACGTCTCTAAGAAGGTGTCCTGGTCCGGCCGGGACCGGGACGACGAGGAGGCGGCGCCGCTGC
TGCGGAGGACGGCGCGGCCCGGCGGGGGGACGCCGCTGCTGAACGGGGCTGGGCCTGGGGCTGCGCGCCA
GTCACCACGTTCTGCGCTTTTCCGAGTCGGACATATGAGCAGCGTGGAGCTGGATGATGAACTTTTGGAC
CCGGATATGGACCCTCCACATCCCTTCCCCAAGGAGATCCCACACAACGAGAAGCTCCTGTCCCTCAAGT
ATGAGAGCTTGGACTATGACAACAGTGAGAACCAGCTGTTCCTGGAGGAGGAGCGGCGGATCAATCACAC
GGCCTTCCGGACGGTGGAGATCAAGCGCTGGGTCATCTGCGCCCTCATTGGGATCCTCACGGGCCTCGTG
GCCTGCTTCATTGACATCGTGGTGGAAAACCTGGCTGGCCTCAAGTACAGGGTCATCAAGGGCAATATCG
ACAAGTTCACAGAGAAGGGCGGACTGTCCTTCTCCCTGTTGCTGTGGGCCACGCTGAACGCCGCCTTCGT
GCTCGTGGGCTCTGTGATTGTGGCTTTCATAGAGCCGGTGGCTGCTGGCAGCGGAATCCCCCAGATCAAG
TGCTTCCTCAACGGGGTGAAGATCCCCCACGTGGTGCGGCTCAAGACGTTGGTGATCAAAGTGTCCGGTG
TGATCCTGTCCGTGGTCGGGGGCCTGGCCGTGGGAAAGGAAGGGCCGATGATCCACTCAGGTTCAGTGAT
TGCCGCCGGGATCTCTCAGGGAAGGTCAACGTCACTGAAACGAGATTTCAAGATCTTCGAGTACTTCCGC
AGAGACACAGAGAAGCGGGACTTCGTCTCCGCAGGGGCTGCGGCCGGAGTGTCAGCGGCGTTTGGAGCCC
CCGTGGGTGGGGTCCTGTTCAGCTTGGAGGAGGGTGCGTCCTTCTGGAACCAGTTCCTGACCTGGAGGAT
CTTCTTTGCTTCCATGATCTCCACGTTCACCCTGAATTTTGTTCTGAGCATTTACCACGGGAACATGTGG
GACCTGTCCAGCCCAGGCCTCATCAACTTCGGAAGGTTTGACTCGGAGAAAATGGCCTACACGATCCACG
AGATCCCGGTCTTCATCGCCATGGGCGTGGTGGGCGGTGTGCTTGGAGCAGTGTTCAATGCCTTGAACTA
CTGGCTGACCATGTTTCGAATCAGGTACATCCACCGGCCCTGCCTGCAGGTGATTGAGGCCGTGCTGGTG
GCCGCCGTCACGGCCACAGTTGCCTTCGTGCTGATCTACTCGTCGCGGGATTGCCAGCCCCTGCAGGGGG
GCTCCATGTCCTACCCGCTGCAGCTCTTTTGTGCAGATGGCGAGTACAACTCCATGGCTGCGGCCTTCTT
CAACACCCCGGAGAAGAGCGTGGTGAGCCTCTTCCACGACCCGCCAGGCTCCTACAACCCCCTGACCCTC
GGCCTGTTCACGCTGGTCTACTTCTTCCTGGCCTGCTGGACCTACGGGCTCACGGTGTCTGCCGGGGTCT
TCATCCCGTCCCTGCTCATCGGGGCTGCCTGGGGCCGGCTCTTTGGGATCTCCCTGTCCTACCTCACGGG
GGCGGCGATCTGGGCGGACCCCGGCAAATACGCCCTGATGGGAGCTGCTGCCCAGCTGGGCGGGATTGTG
CGGATGACACTGAGCCTGACCGTCATCATGATGGAGGCCACCAGCAACGTGACCTACGGCTTCCCCATCA
TGCTGGTGCTCATGACCGCCAAGATCGTGGGCGACGTCTTCATTGAGGGCCTGTACGACATGCACATTCA
GCTGCAGAGTGTGCCCTTCCTGCACTGGGAGGCCCCGGTCACCTCACACTCACTCACTGCCAGGGAGGTG
ATGAGCACACCAGTGACCTGCCTGAGGCGGCGTGAGAAGGTCGGCGTCATTGTGGACGTGCTGAGCGACA
CGGCGTCCAATCACAACGGCTTCCCCGTGGTGGAGCATGCCGATGACACCCAGCCTGCCCGGCTCCAGGG
CCTGATCCTGCGCTCCCAGCTCATCGTTCTCCTAAAGCACAAGGTGTTTGTGGAGCGGTCCAACCTGGGC
CTGGTACAGCGGCGCCTGAGGCTGAAGGACTTCCGAGACGCCTACCCGCGCTTCCCACCCATCCAGTCCA
TCCACGTGTCCCAGGACGAGCGGGAGTGCACCATGGACCTCTCCGAGTTCATGAACCCCTCCCCCTACAC
GGTGCCCCAGGAGGCGTCGCTCCCACGGGTGTTCAAGCTGTTCCGGGCCCTGGGCCTGCGGCACCTGGTG
GTGGTGGACAACCGCAATCAGGTTGTCGGGTTGGTGACCAGGAAGGACCTCGCCAGGTACCGCCTGGGAA
AGAGAGGCTTGGAGGAGCTCTCGCTGGCCCAGACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203450 representing NM_001287
Red=Cloning site Green=Tags(s)

MANVSKKVSWSGRDRDDEEAAPLLRRTARPGGGTPLLNGAGPGAARQSPRSALFRVGHMSSVELDDELLD
PDMDPPHPFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLV
ACFIDIVVENLAGLKYRVIKGNIDKFTEKGGLSFSLLLWATLNAAFVLVGSVIVAFIEPVAAGSGIPQIK
CFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFR
RDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVLSIYHGNMW
DLSSPGLINFGRFDSEKMAYTIHEIPVFIAMGVVGGVLGAVFNALNYWLTMFRIRYIHRPCLQVIEAVLV
AAVTATVAFVLIYSSRDCQPLQGGSMSYPLQLFCADGEYNSMAAAFFNTPEKSVVSLFHDPPGSYNPLTL
GLFTLVYFFLACWTYGLTVSAGVFIPSLLIGAAWGRLFGISLSYLTGAAIWADPGKYALMGAAAQLGGIV
RMTLSLTVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEGLYDMHIQLQSVPFLHWEAPVTSHSLTAREV
MSTPVTCLRRREKVGVIVDVLSDTASNHNGFPVVEHADDTQPARLQGLILRSQLIVLLKHKVFVERSNLG
LVQRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLV
VVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001287
ORF Size 2415 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001287.1, NM_001287.2, NM_001287.3, NM_001287.4, NM_001287.5, NP_001278
RefSeq Size 3760
RefSeq ORF 2418
Locus ID 1186
Cytogenetics 16p13.3
Domains CBS, voltage_CLC
Protein Families Ion Channels: Other, Transmembrane, Druggable Genome
MW 88.5 kDa
Gene Summary The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)