MUS81 (NM_025128) Human Tagged ORF Clone

CAT#: RC203373

Reviews ()
Write a review

MUS81 (Myc-DDK-tagged)-Human MUS81 endonuclease homolog (S. cerevisiae) (MUS81)



Reconstitution Protocol

USD 513.00

In Stock*

Size
    • 10 ug

Product images

Other products for "MUS81"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MUS81
Synonyms SLX3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203373 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCCCGGTCCGCCTGGGCCGGAAGCGCCCGCTGCCTGCCTGTCCCAACCCGCTCTTCGTTCGCT
GGCTGACCGAGTGGCGGGACGAGGCGACCCGCAGCAGGCACCGCACGCGCTTCGTATTTCAGAAGGCGCT
GCGTTCCCTCCGACGGTACCCACTGCCGCTGCGCAGCGGGAAGGAAGCTAAGATCCTACAGCACTTCGGA
GACGGGCTCTGCCGGATGCTGGACGAGCGGCTGCAGCGGCACCGAACATCGGGCGGTGACCATGCCCCGG
ACTCACCATCTGGAGAGAACAGTCCAGCCCCGCAGGGGCGACTTGCGGAAGTCCAGGACTCTTCCATGCC
AGTTCCTGCCCAGCCCAAAGCGGGAGGCTCTGGCAGCTACTGGCCAGCTCGGCACTCAGGAGCCCGAGTG
ATACTGCTGGTGCTCTACCGGGAGCACCTGAATCCTAATGGTCACCACTTCTTAACCAAGGAGGAGCTGC
TGCAGAGGTGTGCTCAGAAGTCCCCCAGGGTAGCCCCTGGGAGTGCCCCACCCTGGCCAGCCCTCCGCTC
CCTCCTTCACAGGAACCTGGTCCTCAGGACACACCAGCCAGCCAGGTACTCATTGACCCCAGAGGGCCTG
GAGCTGGCCCAGAAGTTGGCCGAGTCAGAAGGCCTGAGCTTGCTGAATGTGGGCATCGGGCCCAAGGAGC
CCCCTGGGGAGGAGACAGCAGTGCCAGGAGCAGCTTCAGCAGAGCTTGCCAGTGAAGCAGGGGTCCAGCA
GCAGCCACTGGAGCTGAGGCCTGGAGAGTACAGGGTGCTGTTGTGTGTGGACATTGGCGAGACCCGGGGG
GGCGGGCACAGGCCGGAGCTGCTCCGAGAGCTACAGCGGCTGCACGTGACCCACACGGTGCGCAAGCTGC
ACGTTGGAGATTTTGTGTGGGTGGCTCAGGAGACCAATCCTAGAGACCCAGCAAACCCTGGGGAGTTGGT
ACTGGATCACATTGTGGAGCGCAAGCGACTGGATGACCTTTGCAGCAGCATCATCGACGGCCGCTTCCGG
GAGCAGAAGTTCCGACTGAAGCGCTGTGGTCTGGAGCGCCGGGTATACCTGGTGGAAGAGCATGGTTCCG
TCCACAACCTCAGCCTTCCTGAGAGCACACTGCTGCAGGCTGTCACCAACACTCAGGTCATTGATGGCTT
TTTTGTGAAGCGCACAGCAGACATTAAGGAGTCAGCCGCCTACCTGGCCCTCTTGACTCGGGGCCTGCAG
AGACTCTACCAGGGCCACACCCTACGCAGCCGCCCCTGGGGAACCCCTGGGAACCCTGAATCAGGGGCCA
TGACCTCTCCAAACCCTCTCTGCTCACTCCTCACCTTCAGTGACTTCAACGCAGGAGCCATCAAGAATAA
GGCCCAGTCGGTGCGAGAAGTGTTTGCCCGGCAGCTGATGCAGGTGCGCGGAGTGAGTGGGGAGAAGGCA
GCAGCCCTGGTGGATCGATACAGCACCCCTGCCAGCCTCCTGGCCGCCTATGATGCCTGTGCCACCCCCA
AGGAACAAGAGACACTGCTGAGCACCATTAAGTGTGGGCGTCTACAGAGGAATCTGGGGCCTGCTCTGAG
CAGGACCTTATCCCAGCTCTACTGCAGCTACGGCCCCTTGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203373 protein sequence
Red=Cloning site Green=Tags(s)

MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRHRTRFVFQKALRSLRRYPLPLRSGKEAKILQHFG
DGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGSYWPARHSGARV
ILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPPWPALRSLLHRNLVLRTHQPARYSLTPEGL
ELAQKLAESEGLSLLNVGIGPKEPPGEETAVPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRG
GGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFR
EQKFRLKRCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQ
RLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKA
AALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGPLT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025128
ORF Size 1653 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025128.3, NP_079404.2
RefSeq Size 2406 bp
RefSeq ORF 1656 bp
Locus ID 80198
UniProt ID Q96NY9
Cytogenetics 11q13.1
Domains ERCC4
Protein Pathways Homologous recombination
MW 61.1 kDa
Gene Summary This gene encodes a structure-specific endonuclease which belongs to the XPF/MUS81 endonuclease family and plays a critical role in the resolution of recombination intermediates during DNA repair after inter-strand cross-links, replication fork collapse, and DNA double-strand breaks. The encoded protein associates with one of two closely related essential meiotic endonuclease proteins (EME1 or EME2) to form a complex that processes DNA secondary structures. It contains an N-terminal DEAH helicase domain, an excision repair cross complementation group 4 (ERCC4) endonuclease domain, and two tandem C-terminal helix-hairpin-helix domains. Mice with a homozygous knockout of the orthologous gene have significant meiotic defects including the failure to repair a subset of DNA double strand breaks. [provided by RefSeq, Jun 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.