ATP5MD (NM_032747) Human Tagged ORF Clone
USMG5 (Myc-DDK-tagged)-Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2
"NM_032747" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ATP5MD |
Synonyms | bA792D24.4; DAPIT; HCVFTP2; MC5DN6; USMG5 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203316 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGGTCCAGAAAGTGATGCGCAATACCAGTTCACTGGTATTAAAAAATATTTCAACTCTTATACTC TCACAGGTAGAATGAACTGTGTACTGGCCACATATGGAAGCATTGCATTGATTGTCTTATATTTCAAGTT AAGGTCCAAAAAAACTCCAGCTGTGAAAGCAACA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203316 protein sequence
Red=Cloning site Green=Tags(s) MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_032747 |
ORF Size | 174 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032747.4 |
RefSeq Size | 609 bp |
RefSeq ORF | 177 bp |
Locus ID | 84833 |
UniProt ID | Q96IX5 |
Cytogenetics | 10q24.33 |
Protein Families | Transmembrane |
MW | 6.5 kDa |
Gene Summary | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). Minor subunit required to maintain the ATP synthase population in the mitochondria (PubMed:21345788).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203316L1 | Lenti ORF clone of Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC203316L2 | Lenti ORF clone of Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RC203316L3 | Lenti ORF clone of Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC203316L4 | Lenti ORF clone of Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RG203316 | USMG5 (tGFP-tagged) - Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2 |
USD 350.00 |
|
SC103736 | USMG5 (untagged)-Human up-regulated during skeletal muscle growth 5 homolog (mouse) (USMG5), transcript variant 2 |
USD 150.00 |