ACAD9 (NM_014049) Human Tagged ORF Clone

CAT#: RC203235

Reviews ()
Write a review

ACAD9 (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase family, member 9 (ACAD9), nuclear gene encoding mitochondrial protein, transcript variant 1



  "NM_014049" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACAD9
Synonyms MC1DN20; NPD002
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203235 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGGCTGCGGGCTCTTCCTGCGCACCACGGCTGCGGCTCGTGCCTGCCGGGGTCTGGTGGTCTCTA
CCGCGAACCGGCGGCTACTGCGCACCAGCCCGCCTGTACGAGCTTTCGCCAAAGAGCTTTTCCTAGGCAA
AATCAAGAAGAAAGAAGTTTTCCCATTTCCAGAAGTTAGCCAAGATGAACTTAATGAAATCAATCAGTTC
TTGGGACCCGTGGAAAAATTCTTCACTGAAGAGGTGGACTCCCGAAAAATTGACCAGGAAGGGAAAATCC
CAGATGAAACTTTGGAGAAATTGAAGAGCCTAGGGCTTTTTGGGCTGCAAGTCCCAGAAGAATATGGTGG
CCTGGGCTTCTCCAACACCATGTACTCACGACTAGGGGAGATCATCAGCATGGATGGGTCCATCACTGTG
ACCCTGGCAGCGCACCAGGCTATTGGCCTCAAGGGGATCATCTTGGCTGGCACTGAGGAGCAGAAAGCCA
AATACTTGCCTAAACTGGCGTCCGGGGAGCACATTGCAGCCTTCTGCCTCACGGAGCCAGCCAGTGGGAG
CGATGCAGCCTCAATCCGGAGCAGAGCCACACTAAGTGAAGACAAGAAGCACTACATCCTCAATGGCTCC
AAGGTCTGGATTACTAATGGAGGACTGGCCAATATTTTTACTGTGTTTGCAAAGACTGAGGTCGTTGATT
CTGATGGATCAGTGAAAGACAAAATCACAGCATTCATAGTAGAAAGAGACTTTGGTGGAGTCACTAATGG
GAAACCCGAAGATAAATTAGGCATTCGGGGCTCCAACACTTGTGAAGTCCATTTTGAAAACACCAAGATA
CCTGTGGAAAACATCCTTGGAGAGGTCGGAGATGGGTTTAAGGTGGCCATGAACATCCTCAACAGCGGCC
GGTTCAGCATGGGCAGCGTCGTGGCTGGGCTGCTCAAGAGATTGATTGAAATGACTGCTGAGTACGCCTG
CACAAGGAAACAGTTTAACAAGAGGCTCAGTGAATTTGGATTGATTCAGGAGAAATTTGCACTGATGGCT
CAGAAGGCTTACGTCATGGAGAGTATGACCTACCTCACAGCAGGGATGCTGGACCAACCTGGCTTTCCCG
ACTGCTCCATCGAGGCAGCCATGGTGAAGGTGTTCAGCTCCGAGGCCGCCTGGCAGTGTGTGAGTGAGGC
GCTGCAGATCCTCGGGGGCTTGGGCTACACAAGGGACTATCCGTACGAGCGCATACTGCGTGACACCCGC
ATCCTCCTCATCTTCGAGGGAACCAATGAGATTCTCCGGATGTACATCGCCCTGACGGGTCTGCAGCATG
CCGGCCGCATCCTGACTACCAGGATCCATGAGCTTAAACAGGCCAAAGTGAGCACAGTCATGGATACCGT
TGGCCGGAGGCTTCGGGACTCCCTGGGCCGAACTGTGGACCTGGGGCTGACAGGCAACCATGGAGTTGTG
CACCCTAGTCTTGCGGACAGTGCCAACAAGTTTGAGGAGAACACCTACTGCTTCGGCCGGACCGTGGAGA
CACTGCTGCTCCGCTTTGGCAAGACCATCATGGAGGAGCAGCTGGTACTGAAGCGGGTGGCCAACATCCT
CATCAACCTGTATGGCATGACGGCCGTGCTGTCGCGGGCCAGCCGCTCCATCCGCATTGGGCTCCGCAAC
CACGACCACGAGGTTCTCTTGGCCAACACCTTCTGCGTGGAAGCTTACTTGCAGAATCTCTTCAGCCTCT
CTCAGCTGGACAAGTATGCTCCAGAAAACCTAGATGAGCAGATTAAGAAAGTGTCCCAGCAGATCCTTGA
GAAGCGAGCCTATATCTGTGCCCACCCTCTGGACAGGACATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203235 protein sequence
Red=Cloning site Green=Tags(s)

MSGCGLFLRTTAAARACRGLVVSTANRRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEVSQDELNEINQF
LGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITV
TLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRATLSEDKKHYILNGS
KVWITNGGLANIFTVFAKTEVVDSDGSVKDKITAFIVERDFGGVTNGKPEDKLGIRGSNTCEVHFENTKI
PVENILGEVGDGFKVAMNILNSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMA
QKAYVMESMTYLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTR
ILLIFEGTNEILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVDLGLTGNHGVV
HPSLADSANKFEENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINLYGMTAVLSRASRSIRIGLRN
HDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKVSQQILEKRAYICAHPLDRTC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014049
ORF Size 1863 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014049.3, NP_054768.2
RefSeq Size 2608 bp
RefSeq ORF 1866 bp
Locus ID 28976
UniProt ID Q9H845
Cytogenetics 3q21.3
Domains Acyl-CoA_dh, Acyl-CoA_dh_M, Acyl-CoA_dh_N
MW 68.8 kDa
Gene Summary This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2010]

Other Versions

Other products for "ACAD9"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


ACAD9 mouse monoclonal antibody,clone OTI1D4
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.