ENY2 (NM_020189) Human Tagged ORF Clone

CAT#: RC203231

ENY2 (Myc-DDK-tagged)-Human enhancer of yellow 2 homolog (Drosophila) (ENY2), transcript variant 1

Product Images

Circular map for RC203231

• 

  Western blot validation of overexpression lysate (Cat# LY412611) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203231 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified ENY2 protein (Cat# TP303231). The protein was produced from HEK293T cells transfected with ENY2 cDNA clone (Cat# RC203231) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ENY2
• Synonyms: DC6; e(y)2; Sus1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203231 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTGGTTAGCAAGATGAACAAAGATGCGCAGATGAGAGCAGCGATTAACCAAAAGTTGATAGAAACTG
  GAGAAAGAGAACGCCTCAAAGAGTTGCTGAGAGCTAAATTAATTGAATGTGGCTGGAAGGATCAGTTGAA
  GGCACACTGTAAAGAGGTAATTAAAGAAAAAGGACTAGAACACGTTACTGTTGATGACTTGGTGGCTGAA
  ATCACTCCAAAAGGCAGAGCCCTGGTACCTGACAGTGTAAAGAAGGAGCTCCTACAAAGAATAAGAACAT
  TCCTTGCTCAGCATGCCAGCCTT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203231 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE
  ITPKGRALVPDSVKKELLQRIRTFLAQHASL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_020189
• ORF Size: 303 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_020189.6
• RefSeq Size: 2948 bp
• RefSeq ORF: 306 bp
• Locus ID: 56943
• UniProt ID: Q9NPA8
• Cytogenetics: 8q23.1
• MW: 11.5 kDa
• Gene Summary: Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation (PubMed:18206972, PubMed:21746879). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:23591820).[UniProtKB/Swiss-Prot Function]