GAP43 (NM_002045) Human Tagged ORF Clone

CAT#: RC203175

Reviews ()
Write a review

GAP43 (Myc-DDK-tagged)-Human growth associated protein 43 (GAP43), transcript variant 2



  "NM_002045" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GAP43 (NM_002045) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GAP43
Synonyms B-50; GAP-43; PP46
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC203175 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTGCTGTATGAGAAGAACCAAACAGGTTGAAAAAAATGATGACGACCAAAAGATTGAACAAGATG
GTATCAAACCAGAAGATAAAGCTCATAAGGCCGCAACCAAAATTCAGGCTAGCTTCCGTGGACACATAAC
AAGGAAAAAGCTCAAAGGAGAGAAGAAGGATGATGTCCAAGCTGCTGAGGCTGAAGCTAATAAGAAGGAT
GAAGCCCCTGTTGCCGATGGGGTGGAGAAGAAGGGAGAAGGCACCACTACTGCCGAAGCAGCCCCAGCCA
CTGGCTCCAAGCCTGATGAGCCCGGCAAAGCAGGAGAAACTCCTTCCGAGGAGAAGAAGGGGGAGGGTGA
TGCTGCCACAGAGCAGGCAGCCCCCCAGGCTCCTGCATCCTCAGAGGAGAAGGCCGGCTCAGCTGAGACA
GAAAGTGCCACTAAAGCTTCCACTGATAACTCGCCGTCCTCCAAGGCTGAAGATGCCCCAGCCAAGGAGG
AGCCTAAACAAGCCGATGTGCCTGCTGCTGTCACTGCTGCTGCTGCCACCACCCCTGCCGCAGAGGATGC
TGCTGCCAAGGCAACAGCCCAGCCTCCAACGGAGACTGGGGAGAGCAGCCAAGCTGAAGAGAACATAGAA
GCTGTAGATGAAACCAAACCTAAGGAAAGTGCCCGGCAGGACGAGGGTAAAGAAGAGGAACCTGAGGCTG
ACCAAGAACATGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203175 protein sequence
Red=Cloning site Green=Tags(s)

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD
EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET
ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE
AVDETKPKESARQDEGKEEEPEADQEHA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002045
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002045.4
RefSeq Size 1747 bp
RefSeq ORF 717 bp
Locus ID 2596
Cytogenetics 3q13.31
Domains IQ
MW 24.8 kDa
Gene Summary The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "GAP43"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal GAP-43 Antibody
    • 100 ul

USD 435.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools