Iba1 (AIF1) (NM_032955) Human Tagged ORF Clone
CAT#: RC203154
- TrueORF®
AIF1 (Myc-DDK-tagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_032955" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Iba1 |
Synonyms | AIF-1; IBA1; IRT-1; IRT1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203154 representing NM_032955
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTGAAACGAATGCTGGAGAAACTTG GAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCCAGTGGCTCCGGGGAGACGTT CAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCATCCTAAAAATGATCCTGATGTAT GAGGAAAAAGCGAGAGAAAAGGAAAAGCCAACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203154 representing NM_032955
Red=Cloning site Green=Tags(s) MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY EEKAREKEKPTGPPAKKAISELP myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032955 |
ORF Size | 279 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032955.3 |
RefSeq Size | 503 bp |
RefSeq ORF | 282 bp |
Locus ID | 199 |
UniProt ID | P55008 |
Cytogenetics | 6p21.33 |
Protein Families | Druggable Genome |
MW | 10.5 kDa |
Gene Summary | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203154L1 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged |
USD 465.00 |
|
RC203154L2 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged |
USD 465.00 |
|
RC203154L3 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged |
USD 465.00 |
|
RC203154L4 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged |
USD 465.00 |
|
RG203154 | AIF1 (tGFP-tagged) - Human allograft inflammatory factor 1 (AIF1), transcript variant 1 |
USD 365.00 |
|
SC108920 | AIF1 (untagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review