VIP (NM_003381) Human Tagged ORF Clone

CAT#: RC203126

VIP (Myc-DDK-tagged)-Human vasoactive intestinal peptide (VIP), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_003381" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


VIP mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
    • 100 ul

USD 447.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VIP
Synonyms PHM27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203126 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACACCAGAAATAAGGCCCAGCTCCTTGTGCTCCTGACTCTTCTCAGTGTGCTCTTCTCACAGACTT
CGGCATGGCCTCTTTACAGGGCACCTTCTGCTCTCAGGTTGGGTGACAGAATACCCTTTGAGGGAGCAAA
TGAACCTGATCAAGTTTCATTAAAAGAAGACATTGACATGTTGCAAAATGCATTAGCTGAAAATGACACA
CCCTATTATGATGTATCCAGAAATGCCAGGCATGCTGATGGAGTTTTCACCAGTGACTTCAGTAAACTCT
TGGGTCAACTTTCTGCCAAAAAGTACCTTGAGTCTCTTATGGGAAAACGTGTTAGTAACATCTCAGAAGA
CCCTGTACCAGTCAAACGTCACTCAGATGCAGTCTTCACTGACAACTATACCCGCCTTAGAAAACAAATG
GCTGTAAAGAAATATTTGAACTCAATTCTGAATGGAAAGAGGAGCAGTGAGGGAGAATCTCCCGACTTTC
CAGAAGAGTTAGAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203126 protein sequence
Red=Cloning site Green=Tags(s)

MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDT
PYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQM
AVKKYLNSILNGKRSSEGESPDFPEELEK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003381
ORF Size 507 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003381.4
RefSeq Size 1601 bp
RefSeq ORF 513 bp
Locus ID 7432
UniProt ID P01282
Cytogenetics 6q25.2
Domains GLUCA
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 19.1 kDa
Gene Summary The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.