DCPS (NM_014026) Human Tagged ORF Clone

CAT#: RC203052

DCPS (Myc-DDK-tagged)-Human decapping enzyme, scavenger (DCPS)

Product Images

Circular map for RC203052

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY DCPS (Cat# RC203052, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DCPS(Cat# TA505420). Positive lysates LY415527 (100ug) and LC415527 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY415527) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203052 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified DCPS protein (Cat# TP303052). The protein was produced from HEK293T cells transfected with DCPS cDNA clone (Cat# RC203052) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DCPS
• Synonyms: ARS; DCS1; HINT-5; HINT5; HSL1; HSPC015
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203052 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGACGCAGCTCCTCAACTAGGCAAGAGGAAGCGCGAATTGGACGTGGAGGAGGCCCACGCCGCCA
  GCACAGAGGAAAAGGAGGCAGGAGTTGGAAATGGTACCTGTGCTCCTGTCCGCTTACCGTTCTCCGGCTT
  CAGACTGCAGAAGGTGCTGAGGGAGTCTGCGCGGGACAAAATCATTTTCCTACACGGGAAGGTGAATGAG
  GCCTCTGAGGATGGGGATGGAGAGGATGCCGTTGTGATCCTGGAGAAGACGCCATTTCAGGTGGAACAGG
  TGGCTCAGCTCCTGACGGGCAGCCCTGAGCTCCAATTGCAGTTCTCCAATGATATCTACAGCACCTATCA
  CTTGTTCCCTCCAAGACAACTGAATGATGTAAAGACGACCGTGGTTTACCCTGCCACAGAGAAACACCTG
  CAGAAGTACCTGCGCCAGGACCTCCGCCTGATCCGAGAGACGGGAGATGACTACAGGAACATTACTTTAC
  CCCACCTGGAGTCCCAGAGCCTCAGCATCCAGTGGGTGTATAACATTCTCGACAAGAAGGCTGAAGCGGA
  CCGGATTGTTTTCGAGAACCCAGATCCCTCTGATGGTTTTGTCCTCATCCCTGACCTCAAGTGGAACCAA
  CAGCAGCTCGATGACTTGTACTTGATCGCCATCTGCCATCGCCGGGGCATCAGATCCCTACGCGACCTTA
  CTCCGGAGCACTTGCCGCTGCTCAGGAACATCCTCCACCAGGGGCAGGAGGCCATCCTGCAGCGCTACCG
  GATGAAGGGAGACCATCTGCGAGTATACCTGCACTACCTGCCCTCCTACTACCACCTGCATGTGCACTTC
  ACCGCCCTGGGCTTCGAGGCCCCCGGCTCAGGCGTGGAGCGGGCCCACCTGCTGGCTGAGGTGATCGAGA
  ACTTGGAGTGTGACCCTAGGCACTACCAGCAGCGCACGCTCACCTTCGCCCTCAGGGCTGACGACCCCCT
  GCTCAAGCTCTTGCAGGAGGCTCAGCAAAGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203052 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNE
  ASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHL
  QKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQ
  QQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHF
  TALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014026
• ORF Size: 1011 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014026.6
• RefSeq Size: 1508 bp
• RefSeq ORF: 1014 bp
• Locus ID: 28960
• UniProt ID: Q96C86
• Cytogenetics: 11q24.2
• Protein Pathways: RNA degradation
• MW: 38.7 kDa
• Gene Summary: This gene encodes a member of the histidine triad family of pyrophosphatases that removes short mRNA fragments containing the 5′ mRNA cap structure, which appear in the 3′ → 5′ mRNA decay pathway, following deadenylation and exosome-mediated turnover. This enzyme hydrolyzes the triphosphate linkage of the cap structure (7-methylguanosine nucleoside triphosphate) to yield 7-methylguanosine monophosphate and nucleoside diphosphate. It protects the cell from the potentially toxic accumulation of these short, capped mRNA fragments, and regulates the activity of other cap-binding proteins, which are inhibited by their accumulation. It also acts as a transcript-specific modulator of pre-mRNA splicing and microRNA turnover. [provided by RefSeq, Apr 2017]