S100A4 (NM_002961) Human Tagged ORF Clone
CAT#: RC203035
S100A4 (Myc-DDK-tagged)-Human S100 calcium binding protein A4 (S100A4), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_002961" in other vectors (6)
Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | S100A4 |
Synonyms | 18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203035 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGTGCCCTCTGGAGAAGGCCCTGGATGTGATGGTGTCCACCTTCCACAAGTACTCGGGCAAAGAGG GTGACAAGTTCAAGCTCAACAAGTCAGAACTAAAGGAGCTGCTGACCCGGGAGCTGCCCAGCTTCTTGGG GAAAAGGACAGATGAAGCTGCTTTCCAGAAGCTGATGAGCAACTTGGACAGCAACAGGGACAACGAGGTG GACTTCCAAGAGTACTGTGTCTTCCTGTCCTGCATCGCCATGATGTGTAACGAATTCTTTGAAGGCTTCC CAGATAAGCAGCCCAGGAAGAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203035 protein sequence
Red=Cloning site Green=Tags(s) MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002961 |
ORF Size | 303 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002961.3 |
RefSeq Size | 512 bp |
RefSeq ORF | 306 bp |
Locus ID | 6275 |
UniProt ID | P26447 |
Cytogenetics | 1q21.3 |
Domains | S_100, EFh |
MW | 11.7 kDa |
Gene Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203035L1 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC203035L2 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RC203035L3 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC203035L4 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG203035 | S100A4 (tGFP-tagged) - Human S100 calcium binding protein A4 (S100A4), transcript variant 1 |
USD 350.00 |
|
SC118301 | S100A4 (untagged)-Human S100 calcium binding protein A4 (S100A4), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review