Fascin(FSCN1) (NM_003088) Human Tagged ORF Clone

CAT#: RC203031

FSCN1 (Myc-DDK-tagged)-Human fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) (FSCN1)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fascin(FSCN1) (NM_003088) Human Tagged ORF Clone
Symbol FSCN1
Synonyms FAN1; HSN; p55; SNL
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC203031 representing NM_003088
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGCCAACGGCACAGCCGAGGCGGTGCAGATCCAGTTCGGCCTCATCAACTGCGGCAACAAGTACC
TGACGGCCGAGGCGTTCGGGTTCAAGGTGAACGCGTCCGCCAGCAGCCTGAAGAAGAAGCAGATCTGGAC
GCTGGAGCAGCCCCCTGACGAGGCGGGCAGCGCGGCCGTGTGCCTGCGCAGCCACCTGGGCCGCTACCTG
GCGGCGGACAAGGACGGCAACGTGACCTGCGAGCGCGAGGTGCCCGGTCCCGACTGCCGTTTCCTCATCG
TGGCGCACGACGACGGTCGCTGGTCGCTGCAGTCCGAGGCGCACCGGCGCTACTTCGGCGGCACCGAGGA
CCGCCTGTCCTGCTTCGCGCAGACGGTGTCCCCCGCCGAGAAGTGGAGCGTGCACATCGCCATGCACCCT
CAGGTCAACATCTACAGCGTCACCCGTAAGCGCTACGCGCACCTGAGCGCGCGGCCGGCCGACGAGATCG
CCGTGGACCGCGACGTGCCCTGGGGCGTCGACTCGCTCATCACCCTCGCCTTCCAGGACCAGCGCTACAG
CGTGCAGACCGCCGACCACCGCTTCCTGCGCCACGACGGGCGCCTGGTGGCGCGCCCCGAGCCGGCCACT
GGCTACACGCTGGAGTTCCGCTCCGGCAAGGTGGCCTTCCGCGACTGCGAGGGCCGTTACCTGGCGCCGT
CGGGGCCCAGCGGCACGCTCAAGGCGGGCAAGGCCACCAAGGTGGGCAAGGACGAGCTCTTTGCTCTGGA
GCAGAGCTGCGCCCAGGTCGTGCTGCAGGCGGCCAACGAGAGGAACGTGTCCACGCGCCAGGGTATGGAC
CTGTCTGCCAATCAGGACGAGGAGACCGACCAGGAGACCTTCCAGCTGGAGATCGACCGCGACACCAAAA
AGTGTGCCTTCCGTACCCACACGGGCAAGTACTGGACGCTGACGGCCACCGGGGGCGTGCAGTCCACCGC
CTCCAGCAAGAATGCCAGCTGCTACTTTGACATCGAGTGGCGTGACCGGCGCATCACACTGAGGGCGTCC
AATGGCAAGTTTGTGACCTCCAAGAAGAATGGGCAGCTGGCCGCCTCGGTGGAGACAGCAGGGGACTCAG
AGCTCTTCCTCATGAAGCTCATCAACCGCCCCATCATCGTGTTCCGCGTGGAGCATGGCTTCATCGGCTG
CCGCAAGGTCACGGGCACCCTGGACGCCAACCGCTCCAGCTATGACGTCTTCCAGCTGGAGTTCAACGAT
GGCGCCTACAACATCAAAGACTCCACAGGCAAATACTGGACGGTGGGCAGTGACTCCGTGGTCACCAGCA
GCGGCGACACTCCTGTGGACTTCTTCTTCGAGTTCTGCGACTATAACAAGGTGGCCATCAAGGTGGGCGG
GCGCTACCTGAAGGGCGACCACGCAGGCGTCCTGAAGGCCTCGGCGGAAACCGTTGACCCCGCCTCGCTC
TGGGAGTACAGCGGACCG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203031 representing NM_003088
Red=Cloning site Green=Tags(s)

MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYL
AADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHP
QVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPAT
GYTLEFRSGKVAFRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMD
LSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRAS
NGKFVTSKKNGQLAASVETAGDSELFLMKLINRPIIVFRVEHGFIGCRKVTGTLDANRSSYDVFQLEFND
GAYNIKDSTGKYWTVGSDSVVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASL
WEYSGP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003088
ORF Size 1488 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003088.2, NP_003079
RefSeq Size 2819
RefSeq ORF 1482
Locus ID 6624
Cytogenetics 7p22.1
MW 54.3 kDa
Gene Summary This gene encodes a member of the fascin family of actin-binding proteins. Fascin proteins organize F-actin into parallel bundles, and are required for the formation of actin-based cellular protrusions. The encoded protein plays a critical role in cell migration, motility, adhesion and cellular interactions. Expression of this gene is known to be regulated by several microRNAs, and overexpression of this gene may play a role in the metastasis of multiple types of cancer by increasing cell motility. Expression of this gene is also a marker for Reed-Sternberg cells in Hodgkin's lymphoma. A pseudogene of this gene is located on the long arm of chromosome 15. [provided by RefSeq, Sep 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations