alpha Adaptin (AP2A2) (NM_012305) Human Tagged ORF Clone

CAT#: RC203018

Reviews ()
Write a review

AP2A2 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, alpha 2 subunit (AP2A2)



  "NM_012305" in other vectors (4)

USD 750.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name alpha Adaptin (AP2A2) (NM_012305) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AP2A2
Synonyms ADTAB; CLAPA2; HIP-9; HIP9; HYPJ
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC203018 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGCCGTGTCCAAGGGGGACGGGATGCGGGGCCTGGCGGTCTTCATCTCGGATATCCGCAACTGTA
AAAGTAAAGAAGCAGAAATAAAAAGGATAAACAAGGAACTGGCAAATATCAGATCAAAATTTAAAGGTGA
CAAGGCTCTTGATGGCTATAGTAAAAAAAAGTACGTCTGCAAGTTGCTCTTCATCTTTCTCCTTGGTCAT
GACATTGACTTTGGACACATGGAGGCTGTGAACCTGCTGAGTTCAAACAGATACACGGAAAAGCAGATCG
GCTACCTTTTCATCTCTGTGTTGGTGAACTCAAACAGTGAGCTGATCCGCCTGATCAACAACGCCATCAA
GAATGACCTGGCCAGCCGCAACCCCACCTTCATGGGCCTGGCCCTGCACTGCATCGCCAGCGTGGGCAGC
CGGGAGATGGCCGAGGCCTTCGCCGGGGAGATCCCTAAGGTCCTCGTAGCCGGAGACACTATGGACAGCG
TGAAGCAGAGCGCGGCCCTGTGCTTGCTGCGCCTGTACAGGACGTCCCCCGATCTTGTCCCCATGGGCGA
CTGGACATCCCGAGTGGTGCACCTGCTCAATGACCAGCACTTGGGTGTGGTAACTGCAGCCACAAGTCTG
ATCACCACTTTAGCACAGAAGAACCCAGAAGAGTTTAAAACCTCCGTGTCTCTGGCTGTCTCTAGGCTAA
GCAGAATCGTGACGTCTGCATCCACAGATCTCCAGGATTACACTTACTATTTTGTCCCGGCTCCCTGGCT
GTCTGTCAAACTGCTGAGACTGCTGCAGTGCTACCCACCCCCAGACCCTGCAGTGCGAGGCCGCCTGACT
GAGTGCCTGGAGACCATCCTGAACAAAGCCCAAGAACCGCCCAAGTCGAAGAAGGTCCAGCACTCCAACG
CGAAGAATGCCGTGCTCTTCGAGGCCATCAGCTTAATCATTCACCATGACAGTGAGCCGAACCTGCTCGT
CCGTGCCTGCAACCAGTTGGGCCAGTTTCTGCAGCACCGCGAGACCAACCTGCGCTACCTGGCCCTGGAG
AGCATGTGCACGCTGGCCAGCTCTGAGTTCTCCCATGAGGCTGTCAAGACGCACATCGAGACGGTCATCA
ACGCCCTGAAGACTGAGCGGGACGTGAGCGTGCGGCAGCGGGCCGTGGACCTCCTCTACGCCATGTGCGA
CCGCAGCAACGCCCCACAGATCGTGGCCGAGATGCTGAGCTATCTGGAGACAGCTGACTACTCCATCCGA
GAAGAGATTGTGCTGAAGGTCGCCATCCTGGCTGAGAAGTACGCGGTGGACTACACCTGGTATGTGGATA
CCATCTTGAACTTGATCCGAATTGCTGGTGATTACGTGAGTGAAGAGGTGTGGTACCGAGTCATTCAGAT
CGTCATCAACCGGGACGACGTGCAGGGCTACGCGGCCAAGACTGTGTTCGAGGCTCTTCAGGCTCCCGCG
TGCCACGAGAACCTGGTCAAAGTGGGCGGCTACATCCTGGGGGAGTTTGGAAACTTGATAGCTGGAGACC
CGAGATCCAGCCCGCTGATCCAGTTCCACCTGCTGCACTCCAAGTTCCACCTGTGCAGCGTCCCCACCCG
CGCGCTGCTCCTGTCCACCTACATCAAGTTCGTGAACCTCTTCCCGGAGGTGAAGCCCACCATCCAGGAC
GTGCTGCGCAGCGACAGCCAGCTCAGGAACGCAGACGTGGAGCTGCAGCAGCGTGCTGTGGAGTACCTGC
GGCTCAGCACCGTGGCCAGCACCGACATTCTGGCGACCGTGCTGGAGGAGATGCCCCCATTCCCGGAGCG
GGAGTCCTCCATCTTGGCAAAGCTCAAGAAGAAGAAGGGCCCCAGCACGGTGACAGACCTGGAGGACACC
AAGCGGGACAGGAGTGTGGACGTGAACGGGGGTCCTGAGCCTGCCCCAGCCAGTACCAGCGCCGTGTCTA
CGCCTTCTCCGTCGGCAGACCTGCTGGGTCTCGGGGCTGCCCCCCCTGCCCCCGCGGGCCCCCCACCCTC
CTCCGGCGGCAGCGGGCTGCTCGTGGACGTGTTCTCAGACTCGGCCTCTGTGGTCGCGCCTCTCGCTCCT
GGCTCCGAAGACAACTTTGCCAGGTTTGTTTGTAAAAACAATGGTGTGTTGTTTGAAAACCAGCTGCTTC
AAATTGGACTTAAGTCTGAATTTCGGCAGAATTTAGGTCGGATGTTTATCTTTTATGGTAATAAGACCTC
CACGCAGTTCCTAAACTTTACCCCAACACTAATCTGTTCAGACGACCTTCAGCCTAACCTGAACCTGCAG
ACCAAGCCCGTGGACCCGACCGTGGAGGGGGGCGCGCAGGTGCAGCAGGTGGTCAACATAGAGTGCGTGT
CCGACTTCACGGAGGCGCCAGTCCTCAACATTCAGTTCAGGTATGGGGGCACCTTCCAGAACGTGTCTGT
GCAGCTGCCCATCACTCTCAACAAATTCTTCCAGCCGACAGAAATGGCTTCTCAGGATTTCTTTCAACGT
TGGAAGCAGTTGAGCAATCCACAGCAGGAAGTGCAGAACATCTTCAAAGCAAAGCACCCAATGGACACAG
AAGTCACCAAAGCCAAGATCATTGGATTTGGTTCTGCACTTCTTGAAGAAGTTGATCCTAATCCTGCGAA
TTTCGTGGGAGCTGGAATCATCCACACGAAAACCACCCAGATTGGATGCCTGCTGCGCTTGGAGCCGAAC
CTGCAAGCCCAGATGTACCGGCTCACGCTGCGCACAAGTAAGGAAGCCGTTTCTCAGAGATTATGTGAAT
TGCTCTCAGCGCAGTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203018 protein sequence
Red=Cloning site Green=Tags(s)

MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGH
DIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMGLALHCIASVGS
REMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLNDQHLGVVTAATSL
ITTLAQKNPEEFKTSVSLAVSRLSRIVTSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLT
ECLETILNKAQEPPKSKKVQHSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALE
SMCTLASSEFSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSIR
EEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAKTVFEALQAPA
CHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRALLLSTYIKFVNLFPEVKPTIQD
VLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLEEMPPFPERESSILAKLKKKKGPSTVTDLEDT
KRDRSVDVNGGPEPAPASTSAVSTPSPSADLLGLGAAPPAPAGPPPSSGGSGLLVDVFSDSASVVAPLAP
GSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNLNLQ
TKPVDPTVEGGAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQR
WKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPN
LQAQMYRLTLRTSKEAVSQRLCELLSAQF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012305
ORF Size 2817 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012305.1, NM_012305.2, NM_012305.3, NP_036437.1
RefSeq Size 4671 bp
RefSeq ORF 2820 bp
Locus ID 161
Cytogenetics 11p15.5
Protein Pathways Endocytosis, Huntington's disease
MW 104 kDa
Gene Summary The protein encoded by this gene is a subunit of the AP-2 adaptor protein complex, which is involved in linking lipid and protein membrane components with the clathrin lattice. This interaction supports the formation of clathrin-coated vesicles, and the encoded subunit aids in the process by binding polyphosphoinositide-containing lipids in the cell membrane. [provided by RefSeq, Nov 2016]

Citations (1)

Other Versions

Other products for "AP2A2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal AP2A2 Antibody (Center)
    • 400 ul

USD 450.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools