ZKSCAN3 (NM_024493) Human Tagged ORF Clone

CAT#: RC202971

Reviews ()
Write a review

ZKSCAN3 (Myc-DDK-tagged)-Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3)



Reconstitution Protocol

USD 501.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ZKSCAN3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZKSCAN3
Synonyms dJ874C20.1; dJ874C20.1.; ZF47; zfp-47; Zfp47; ZFP306; ZNF306; ZNF309; ZSCAN13; ZSCAN35
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAGAGAATTAAGTGAAAGCACAGCCCTGGATGCCCAGTCTACAGAAGACCAGATGGAGCTTCTGG
TCATAAAGGTGGAGGAAGAAGAAGCCGGTTTTCCCAGTAGCCCAGATCTGGGTTCTGAGGGCTCCCGCGA
GCGCTTCCGAGGCTTCCGCTACCCGGAGGCTGCAGGCCCCCGCGAGGCGCTGAGTCGGCTCCGAGAGCTC
TGCCGACAGTGGCTGCAGCCTGAGATGCACAGCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGT
TCCTGACCATCCTGCCGGGGAATCTGCAGAGCTGGGTGCGGGAGCAGCATCCAGAGAGCGGGGAGGAGGT
GGTGGTGCTATTGGAGTATTTGGAGAGGCAGCTGGATGAGCCGGCGCCGCAGGTTTCAGGTGTTGACCAG
GGGCAAGAACTGCTCTGTTGCAAGATGGCACTATTGACACCAGCCCCAGGGTCACAAAGTAGCCAATTTC
AGCTAATGAAGGCTCTGCTCAAGCATGAATCTGTGGGATCCCAGCCTTTACAAGATAGAGTTCTCCAGGT
CCCCATGCTTGCCCATGGAGGATGCTGCAGAGAAGATGCAGTGGTAGCTTCTAGGCTTACTCCAGAGTCC
CAGGGGTTGTTGAAAGTGGAAGATGTGGCCCTGACCCTCACCCCTGAATGGACACAGCAGGATTCATCTC
AGGGGAATCTCTGTAGAGATGAAAAGCAGGAGAACCATGGCAGCCTGGTCTCCCTGGGTGATGAAAAACA
GACTAAGAGCAGGGACTTGCCTCCAGCTGAGGAGCTTCCAGAAAAGGAGCATGGGAAGATATCGTGCCAC
CTGAGAGAAGACATTGCCCAGATTCCTACATGTGCAGAAGCTGGTGAACAGGAGGGCAGGCTACAAAGAA
AGCAGAAAAATGCCACAGGAGGGAGGCGGCACATCTGCCATGAATGTGGAAAGAGTTTTGCTCAAAGCTC
AGGCCTGAGTAAACACAGGAGAATCCACACTGGTGAGAAACCCTACGAATGTGAAGAGTGTGGCAAAGCC
TTCATTGGGAGCTCTGCCCTTGTCATTCATCAGAGAGTCCACACTGGTGAGAAGCCATATGAGTGTGAAG
AATGTGGTAAGGCCTTCAGTCATAGCTCAGACCTTATCAAGCATCAGAGAACCCACACTGGGGAGAAGCC
CTATGAGTGTGATGACTGTGGGAAGACCTTCAGCCAGAGCTGCAGCCTCCTTGAACATCACAGAATCCAC
ACTGGGGAGAAGCCGTATCAGTGCAGTATGTGTGGCAAAGCCTTTAGGCGAAGTTCACATCTCCTGAGAC
ATCAGAGGATCCATACTGGGGATAAAAATGTTCAGGAACCTGAGCAGGGAGAGGCCTGGAAAAGTAGGAT
GGAAAGCCAGTTGGAAAATGTTGAAACTCCCATGTCTTATAAATGTAATGAGTGTGAAAGAAGTTTCACT
CAGAATACAGGCCTCATTGAACATCAAAAAATCCACACTGGTGAGAAACCCTATCAGTGTAATGCGTGTG
GAAAAGGCTTCACCCGAATTTCATACCTTGTTCAACATCAGAGAAGCCATGTAGGGAAAAACATCCTATC
ACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202971 protein sequence
Red=Cloning site Green=Tags(s)

MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL
CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ
GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPMLAHGGCCREDAVVASRLTPES
QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH
LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA
FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT
QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024493
ORF Size 1614 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024493.1, NP_077819.1
RefSeq Size 4725 bp
RefSeq ORF 1617 bp
Locus ID 80317
UniProt ID Q9BRR0
Cytogenetics 6p22.1
Domains KRAB, LER, zf-C2H2
Protein Families Transcription Factors
MW 60.6 kDa
Gene Summary Transcriptional factor that binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3' and acts as a repressor of autophagy. Specifically represses expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or WIPI2. Associates with chromatin at the ITGB4 and VEGF promoters. Also acts as a transcription activator and promotes cancer cell progression and/or migration in various tumors and myelomas.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.