HMGA1(HMGA1) (NM_145899) Human Tagged ORF Clone

CAT#: RC202928

HMGA1 (Myc-DDK-tagged)-Human high mobility group AT-hook 1 (HMGA1), transcript variant 1

Change vector?

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HMGA1(HMGA1) (NM_145899) Human Tagged ORF Clone
Symbol HMGA1
Synonyms HMG-R; HMGA1A; HMGIY
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202928 representing NM_145899
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAGTCGAGCTCGAAGTCCAGCCAGCCCTTGGCCTCCAAGCAGGAAAAGGACGGCACTGAGAAGC
GGGGCCGGGGCAGGCCGCGCAAGCAGCCTCCGGTGAGTCCCGGGACAGCGCTGGTAGGGAGTCAGAAGGA
GCCCAGCGAAGTGCCAACACCTAAGAGACCTCGGGGCCGACCAAAGGGAAGCAAAAACAAGGGTGCTGCC
AAGACCCGGAAAACCACCACAACTCCAGGAAGGAAACCAAGGGGCAGACCCAAAAAACTGGAGAAGGAGG
AAGAGGAGGGCATCTCGCAGGAGTCCTCGGAGGAGGAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202928 representing NM_145899
Red=Cloning site Green=Tags(s)

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA
KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145899
ORF Size 321 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145899.1, NM_145899.2, NP_665906
RefSeq Size 1958
RefSeq ORF 324
Locus ID 3159
Cytogenetics 6p21.31
Protein Families Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell - Pluripotency, Transcription Factors, Druggable Genome
MW 11.5 kDa
Gene Summary This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations