Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Tagged ORF Clone

CAT#: RC202924

Reviews ()
Write a review

NFE2 (Myc-DDK-tagged)-Human nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 1



  "NM_006163" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFE2
Synonyms NF-E2; p45
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202924 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCCGTGTCCTCCCCAGCAGAGCAGGAACAGGGTGATACAGCTGTCCACTTCAGAGCTAGGAGAGA
TGGAACTGACTTGGCAGGAGATCATGTCCATCACCGAGCTGCAGGGTCTGAATGCTCCAAGTGAGCCATC
ATTTGAGCCCCAAGCCCCAGCTCCATACCTTGGACCTCCACCACCCACAACTTACTGCCCCTGCTCAATC
CACCCAGATTCTGGCTTCCCACTTCCTCCACCACCTTATGAGCTCCCAGCATCCACATCCCATGTCCCAG
ATCCCCCATACTCCTATGGCAACATGGCCATACCAGTCTCCAAGCCACTGAGCCTCTCAGGCCTGCTCAG
TGAGCCGCTCCAAGACCCCTTAGCCCTCCTGGACATTGGGCTGCCAGCAGGGCCACCTAAGCCCCAAGAA
GACCCAGAATCCGACTCAGGATTATCCCTCAACTATAGCGATGCTGAATCTCTTGAGCTGGAGGGGACAG
AGGCTGGTCGGCGGCGCAGCGAATATGTAGAGATGTACCCAGTGGAGTACCCCTACTCACTCATGCCCAA
CTCCTTGGCCCACTCCAACTATACCTTGCCAGCTGCTGAGACCCCCTTGGCCTTAGAGCCCTCCTCAGGC
CCTGTGCGGGCTAAGCCCACTGCACGGGGGGAGGCAGGGAGTCGGGATGAACGTCGGGCCTTGGCCATGA
AGATTCCTTTTCCTACGGACAAGATTGTCAACTTGCCGGTAGATGACTTTAATGAGCTATTGGCAAGGTA
CCCGCTGACAGAGAGCCAGCTAGCGCTAGTCCGGGACATCCGACGACGGGGCAAAAACAAGGTGGCAGCC
CAGAACTGCCGCAAGAGGAAGCTGGAAACCATTGTGCAGCTGGAGCGGGAGCTGGAGCGGCTGACCAATG
AACGGGAGCGGCTTCTCAGGGCCCGCGGGGAGGCAGACCGGACCCTGGAGGTCATGCGCCAACAGCTGAC
AGAGCTGTACCGTGACATTTTCCAGCACCTTCGGGATGAATCAGGCAACAGCTACTCTCCTGAAGAGTAC
GCGCTGCAACAGGCTGCCGATGGGACCATCTTCCTTGTGCCCCGGGGGACCAAGATGGAGGCCACAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202924 protein sequence
Red=Cloning site Green=Tags(s)

MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI
HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE
DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG
PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA
QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY
ALQQAADGTIFLVPRGTKMEATD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006163
ORF Size 1119 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006163.2
RefSeq Size 1697 bp
RefSeq ORF 1122 bp
Locus ID 4778
UniProt ID Q16621
Cytogenetics 12q13.13
Protein Families Transcription Factors
MW 41.5 kDa
Gene Summary Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "NFE2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit Polyclonal Anti-NFE2 Antibody - middle region
    • 100 ul

USD 475.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.