FOXO3 (NM_201559) Human Tagged ORF Clone

CAT#: RC202894

Reviews ()
Write a review

FOXO3 (Myc-DDK-tagged)-Human forkhead box O3 (FOXO3), transcript variant 2



  "NM_201559" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FOXO3
Synonyms AF6q21; FKHRL1; FKHRL1P2; FOXO2; FOXO3A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202894 representing NM_201559
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGGCACCGGCTTCCCCGGCCCCGCTCTCTCCGCTCGAAGTGGAGCTGGACCCGGAGTTCGAGC
CCCAGAGCCGTCCGCGATCCTGTACGTGGCCCCTGCAAAGGCCGGAGCTCCAAGCGAGCCCTGCCAAGCC
CTCGGGGGAGACGGCCGCCGACTCCATGATCCCCGAGGAGGAGGACGATGAAGACGACGAGGACGGCGGG
GGACGGGCCGGCTCGGCCATGGCGATCGGCGGCGGCGGCGGGAGCGGCACGCTGGGCTCCGGGCTGCTCC
TTGAGGACTCGGCCCGGGTGCTGGCACCCGGAGGGCAAGACCCCGGGTCTGGGCCAGCCACCGCGGCGGG
CGGGCTGAGCGGGGGTACACAGGCGCTGCTGCAGCCTCAGCAACCGCTGCCACCGCCGCAGCCGGGGGCG
GCTGGGGGCTCCGGGCAGCCGAGGAAATGTTCGTCGCGGCGGAACGCCTGGGGAAACCTGTCCTACGCGG
ACCTGATCACCCGCGCCATCGAGAGCTCCCCGGACAAACGGCTCACTCTGTCCCAGATCTACGAGTGGAT
GGTGCGTTGCGTGCCCTACTTCAAGGATAAGGGCGACAGCAACAGCTCTGCCGGCTGGAAGAACTCCATC
CGGCACAACCTGTCACTGCATAGTCGATTCATGCGGGTCCAGAATGAGGGAACTGGCAAGAGCTCTTGGT
GGATCATCAACCCTGATGGGGGGAAGAGCGGAAAAGCCCCCCGGCGGCGGGCTGTCTCCATGGACAATAG
CAACAAGTATACCAAGAGCCGTGGCCGCGCAGCCAAGAAGAAGGCAGCCCTGCAGACAGCCCCCGAATCA
GCTGACGACAGTCCCTCCCAGCTCTCCAAGTGGCCTGGCAGCCCCACGTCACGCAGCAGTGATGAGCTGG
ATGCGTGGACGGACTTCCGTTCACGCACCAATTCTAACGCCAGCACAGTCAGTGGCCGCCTGTCGCCCAT
CATGGCAAGCACAGAGTTGGATGAAGTCCAGGACGATGATGCGCCTCTCTCGCCCATGCTCTACAGCAGC
TCAGCCAGCCTGTCACCTTCAGTAAGCAAGCCGTGCACGGTGGAACTGCCACGGCTGACTGATATGGCAG
GCACCATGAATCTGAATGATGGGCTGACTGAAAACCTCATGGACGACCTGCTGGATAACATCACGCTCCC
GCCATCCCAGCCATCGCCCACTGGGGGACTCATGCAGCGGAGCTCTAGCTTCCCGTATACCACCAAGGGC
TCGGGCCTGGGCTCCCCAACCAGCTCCTTTAACAGCACGGTGTTCGGACCTTCATCTCTGAACTCCCTAC
GCCAGTCTCCCATGCAGACCATCCAAGAGAACAAGCCAGCTACCTTCTCTTCCATGTCACACTATGGTAA
CCAGACACTCCAGGACCTGCTCACTTCGGACTCACTTAGCCACAGCGATGTCATGATGACACAGTCGGAC
CCCTTGATGTCTCAGGCCAGCACCGCTGTGTCTGCCCAGAATTCCCGCCGGAACGTGATGCTTCGCAATG
ATCCGATGATGTCCTTTGCTGCCCAGCCTAACCAGGGAAGTTTGGTCAATCAGAACTTGCTCCACCACCA
GCACCAAACCCAGGGCGCTCTTGGTGGCAGCCGTGCCTTGTCGAATTCTGTCAGCAACATGGGCTTGAGT
GAGTCCAGCAGCCTTGGGTCAGCCAAACACCAGCAGCAGTCTCCTGTCAGCCAGTCTATGCAAACCCTCT
CGGACTCTCTCTCAGGCTCCTCCTTGTACTCAACTAGTGCAAACCTGCCCGTCATGGGCCATGAGAAGTT
CCCCAGCGACTTGGACCTGGACATGTTCAATGGGAGCTTGGAATGTGACATGGAGTCCATTATCCGTAGT
GAACTCATGGATGCTGATGGGTTGGATTTTAACTTTGATTCCCTCATCTCCACACAGAATGTTGTTGGTT
TGAACGTGGGGAACTTCACTGGTGCTAAGCAGGCCTCATCTCAGAGCTGGGTGCCAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202894 representing NM_201559
Red=Cloning site Green=Tags(s)

MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG
GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA
AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI
RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES
ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS
SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD
PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS
ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS
ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_201559
ORF Size 2019 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_201559.3
RefSeq Size 3311 bp
RefSeq ORF 2022 bp
Locus ID 2309
UniProt ID O43524
Cytogenetics 6q21
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Chemokine signaling pathway, Endometrial cancer, Neurotrophin signaling pathway, Non-small cell lung cancer
MW 71.1 kDa
Gene Summary This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "FOXO3"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


FOXO3 mouse monoclonal antibody,clone OTI5F11
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.