TRIM26 (NM_003449) Human Tagged ORF Clone

CAT#: RC202881

Reviews ()
Write a review

TRIM26 (Myc-DDK-tagged)-Human tripartite motif containing 26 (TRIM26)



  "NM_003449" in other vectors (4)

Reconstitution Protocol

USD 502.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TRIM26"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIM26
Synonyms AFP; RNF95; ZNF173
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202881 representing NM_003449
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACGTCAGCCCCACTACGGAGCCTGGAAGAGGAGGTGACCTGCTCCATCTGTCTTGATTACCTGC
GGGACCCTGTGACCATTGACTGTGGCCACGTCTTCTGCCGCAGCTGCACCACAGACGTCCGCCCCATCTC
AGGGAGCCGCCCCGTCTGCCCACTCTGCAAGAAGCCTTTTAAGAAGGAGAACATCCGACCCGTGTGGCAA
CTGGCCAGCCTGGTGGAGAACATTGAGCGGCTGAAGGTGGACAAGGGCAGGCAGCCGGGAGAGGTGACCC
GGGAGCAGCAGGATGCAAAGTTGTGCGAGCGACACCGAGAGAAGCTGCACTACTACTGTGAGGACGACGG
GAAGCTGCTGTGCGTGATGTGCCGGGAGTCCCGGGAGCACAGGCCCCACACGGCCGTCCTCATGGAGAAG
GCCGCCCAGCCCCACAGGGAAAAAATCCTGAACCACCTGAGTACCCTAAGGAGGGACAGAGACAAAATTC
AGGGCTTCCAGGCAAAGGGAGAAGCTGATATCCTGGCCGCGCTGAAGAAGCTCCAGGACCAGAGGCAGTA
CATTGTGGCTGAGTTTGAGCAGGGTCATCAGTTCCTGAGGGAGCGGGAGGAACACCTGCTGGAACAGCTG
GCGAAGCTGGAGCAGGAGCTCACGGAGGGCAGGGAGAAGTTCAAGAGCCGGGGCGTCGGGGAGCTTGCCC
GGCTGGCCCTGGTCATCTCCGAACTGGAGGGCAAGGCGCAGCAGCCAGCTGCAGAGCTCATGCAGGACAC
GAGAGACTTCCTAAACAGGTATCCACGGAAGAAGTTCTGGGTTGGGAAACCCATTGCTCGAGTGGTTAAA
AAAAAGACCGGAGAATTCTCAGATAAACTCCTCTCTCTGCAACGAGGCCTGAGGGAATTCCAGGGGAAGC
TGCTGAGAGACTTGGAATATAAGACAGTGAGCGTCACCCTGGACCCACAGTCGGCCAGTGGGTACCTGCA
GCTGTCAGAGGACTGGAAGTGCGTGACCTACACCAGCCTGTACAAGAGTGCCTACCTGCACCCCCAGCAG
TTTGACTGTGAGCCTGGGGTGCTAGGCAGCAAGGGCTTCACCTGGGGCAAGGTCTACTGGGAAGTGGAAG
TGGAGAGGGAGGGCTGGTCTGAGGATGAAGAAGAGGGGGATGAGGAGGAAGAGGGAGAAGAGGAGGAGGA
GGAAGAGGAGGCCGGCTATGGGGATGGATATGACGACTGGGAAACGGACGAAGATGAGGAATCGTTGGGC
GATGAAGAGGAAGAAGAGGAGGAGGAAGAGGAGGAAGTTCTGGAAAGCTGCATGGTGGGGGTGGCTAGAG
ACTCTGTGAAGAGGAAGGGAGACCTCTCCCTGCGGCCAGAGGATGGCGTGTGGGCGCTGCGCCTCTCCTC
CTCCGGCATCTGGGCCAACACCAGCCCCGAGGCTGAGCTTTTCCCAGCACTGCGGCCCCGGAGAGTGGGC
ATCGCCCTGGATTATGAAGGGGGCACCGTGACTTTCACCAACGCAGAGTCACAGGAACTCATCTACACCT
TCACTGCCACCTTCACCCGGCGCCTGGTCCCCTTCCTGTGGCTCAAGTGGCCAGGAACACGCCTCCTGCT
AAGACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202881 representing NM_003449
Red=Cloning site Green=Tags(s)

MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQ
LASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEK
AAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQL
AKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVK
KKTGEFSDKLLSLQRGLREFQGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQ
FDCEPGVLGSKGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAELFPALRPRRVG
IALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003449
ORF Size 1617 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003449.5
RefSeq Size 3499 bp
RefSeq ORF 1620 bp
Locus ID 7726
UniProt ID Q12899
Cytogenetics 6p22.1
Domains zf-B_box, RING, SPRY, PRY
Protein Families Druggable Genome
MW 62 kDa
Gene Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.