HIF1AN (NM_017902) Human Tagged ORF Clone

CAT#: RC202843

Reviews ()
Write a review

HIF1AN (Myc-DDK-tagged)-Human hypoxia inducible factor 1, alpha subunit inhibitor (HIF1AN)



  "NM_017902" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HIF1AN
Synonyms FIH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202843 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGACAGCGGCGGAGGCTGTGGCCTCTGGCTCTGGAGAGCCCCGGGAGGAGGCTGGAGCCCTCG
GCCCCGCCTGGGATGAATCCCAGTTGCGCAGTTATAGCTTCCCGACTAGGCCCATTCCGCGTCTGAGTCA
GAGCGACCCCCGGGCAGAGGAGCTTATTGAGAATGAGGAGCCTGTGGTGCTGACCGACACAAATCTTGTG
TATCCTGCCCTGAAATGGGACCTTGAATACCTGCAAGAGAATATTGGCAATGGAGACTTCTCTGTGTACA
GTGCCAGCACCCACAAGTTCTTGTACTATGATGAGAAGAAGATGGCCAATTTCCAGAACTTTAAGCCGAG
GTCCAACAGGGAAGAAATGAAATTTCATGAGTTCGTTGAGAAACTGCAGGATATACAGCAGCGAGGAGGG
GAAGAGAGGTTGTATCTGCAGCAAACGCTCAATGACACTGTGGGCAGGAAGATTGTCATGGACTTCTTAG
GTTTTAACTGGAACTGGATTAATAAGCAACAGGGAAAGCGTGGCTGGGGGCAGCTTACCTCTAACCTGCT
GCTCATTGGCATGGAAGGAAATGTGACACCTGCTCACTATGATGAGCAGCAGAACTTTTTTGCTCAGATA
AAAGGTTACAAACGATGCATCTTATTCCCTCCGGATCAGTTCGAGTGCCTCTACCCATACCCTGTTCATC
ACCCATGTGACAGACAGAGCCAGGTGGACTTTGACAATCCCGACTACGAGAGGTTCCCTAATTTCCAAAA
TGTGGTTGGTTACGAAACAGTGGTTGGCCCTGGTGATGTTCTTTACATCCCAATGTACTGGTGGCATCAC
ATAGAGTCATTACTAAATGGGGGGATTACCATCACTGTGAACTTCTGGTATAAGGGGGCTCCCACCCCTA
AGAGAATTGAATATCCTCTCAAAGCTCATCAGAAAGTGGCCATAATGAGAAACATTGAGAAGATGCTTGG
AGAGGCCTTGGGGAACCCACAAGAGGTGGGGCCCTTGTTGAACACAATGATCAAGGGCCGATACAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202843 protein sequence
Red=Cloning site Green=Tags(s)

MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLV
YPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGG
EERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQI
KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHH
IESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017902
ORF Size 1047 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017902.3
RefSeq Size 6928 bp
RefSeq ORF 1050 bp
Locus ID 55662
UniProt ID Q9NWT6
Cytogenetics 10q24.31
Protein Families Druggable Genome
MW 40.3 kDa
Gene Summary Hydroxylates HIF-1 alpha at 'Asn-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "HIF1AN"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit Polyclonal Anti-HIF1AN Antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.