LSM3 (NM_014463) Human Tagged ORF Clone

CAT#: RC202793

LSM3 (Myc-DDK-tagged)-Human LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM3)

Product Images

Circular map for RC202793

• 

  Western blot validation of overexpression lysate (Cat# LY415266) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202793 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified LSM3 protein (Cat# TP302793). The protein was produced from HEK293T cells transfected with LSM3 cDNA clone (Cat# RC202793) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: LSM3
• Synonyms: SMX4; USS2; YLR438C
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202793 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGACGACGTAGACCAGCAACAAACTACCAACACTGTAGAGGAGCCCCTGGATCTTATCAGGCTCA
  GCCTAGATGAGCGAATTTATGTGAAAATGAGAAATGACCGAGAGCTTCGAGGCAGATTACATGCTTATGA
  TCAACATTTAAATATGATCTTGGGAGATGTGGAAGAAACTGTGACTACTATAGAAATTGATGAAGAAACA
  TATGAAGAGATATATAAATCAACGAAACGGAATATTCCAATGCTCTTTGTCCGGGGAGATGGCGTTGTCC
  TGGTTGCCCCCCCACTGAGAGTTGGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202793 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET
  YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014463
• ORF Size: 306 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014463.3
• RefSeq Size: 695 bp
• RefSeq ORF: 309 bp
• Locus ID: 27258
• UniProt ID: P62310
• Cytogenetics: 3p25.1
• Domains: Sm
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation, Spliceosome
• MW: 11.8 kDa
• Gene Summary: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004]