TDO2 (NM_005651) Human Tagged ORF Clone

CAT#: RC202777

TDO2 (Myc-DDK-tagged)-Human tryptophan 2,3-dioxygenase (TDO2)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TDO2 (NM_005651) Human Tagged ORF Clone
Symbol TDO2
Synonyms TDO; TO; TPH2; TRPO
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202777 representing NM_005651
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGGTGCCCATTTTTAGGAAACAACTTTGGATATACTTTTAAAAAACTCCCCGTAGAAGGCAGCG
AAGAAGACAAATCACAAACTGGTGTGAATAGAGCCAGCAAAGGAGGTCTTATCTATGGGAACTACCTGCA
TTTGGAAAAAGTTTTGAATGCACAAGAACTGCAAAGTGAAACAAAAGGAAATAAAATCCATGATGAACAT
CTTTTTATCATAACTCATCAAGCTTATGAACTCTGGTTTAAGCAAATCCTCTGGGAGTTGGATTCTGTTC
GAGAGATCTTTCAGAATGGCCATGTCAGAGATGAAAGGAACATGCTTAAGGTTGTTTCTCGGATGCACCG
AGTGTCAGTGATCCTGAAACTGCTGGTGCAGCAGTTTTCCATTCTGGAGACGATGACAGCCTTGGACTTC
AATGACTTCAGAGAGTACTTATCTCCAGCATCAGGCTTCCAGAGTTTGCAATTCCGACTATTAGAAAACA
AGATAGGTGTTCTTCAGAACATGAGAGTCCCTTATAACAGAAGACATTATCGTGATAACTTCAAAGGAGA
AGAAAATGAACTGCTACTTAAATCTGAGCAGGAAAAGACACTTCTGGAATTAGTGGAGGCATGGCTGGAA
AGAACTCCAGGTTTAGAGCCACATGGATTTAACTTCTGGGGAAAGCTTGAAAAAAATATCACCAGAGGCC
TGGAAGAGGAATTCATAAGGATTCAGGCTAAAGAAGAGTCTGAAGAAAAAGAGGAACAGGTGGCTGAATT
TCAGAAGCAAAAAGAGGTGCTACTGTCCTTATTTGATGAGAAACGTCATGAACATCTCCTTAGTAAAGGT
GAAAGACGGCTGTCATACAGAGCACTTCAGGGAGCATTGATGATATATTTTTACAGGGAAGAGCCTAGGT
TCCAGGTGCCTTTTCAGTTGCTGACTTCTCTTATGGACATAGATTCACTGATGACCAAATGGAGATATAA
CCATGTGTGCATGGTGCACAGAATGCTGGGCAGCAAAGCTGGCACCGGTGGTTCCTCAGGCTATCACTAC
CTGCGATCAACTGTGAGTGATAGGTACAAGGTATTTGTAGATTTATTTAATCTTTCAACATACCTGATTC
CCCGACACTGGATACCGAAGATGAACCCAACCATTCACAAATTTCTATATACAGCAGAATACTGTGATAG
CTCCTACTTCAGCAGTGATGAATCAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202777 representing NM_005651
Red=Cloning site Green=Tags(s)

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEH
LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDF
NDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLE
RTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG
ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY
LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005651
ORF Size 1218 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005651.1, NM_005651.2, NM_005651.3, NP_005642
RefSeq Size 1712
RefSeq ORF 1221
Locus ID 6999
Cytogenetics 4q32.1
Domains Trp_dioxygenase
Protein Pathways Tryptophan metabolism, Metabolic pathways
MW 47.7 kDa
Gene Summary This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism. [provided by RefSeq, Feb 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.