PAR4 (PAWR) (NM_002583) Human Tagged ORF Clone

CAT#: RC202733

Reviews ()
Write a review

PAWR (Myc-DDK-tagged)-Human PRKC, apoptosis, WT1, regulator (PAWR)



  "NM_002583" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PAWR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PAWR
Synonyms Par-4; PAR4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202733 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGA
AGGCGAAACGCGAGAAGATGCGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAG
CGACGCCGCTGGGAAGCCCCCCGCGGGGGCTCTGGGCACCCCGGCGGCCGCCGCTGCCAACGAGCTCAAC
AACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCCCGGGGGCGTGAACTGCGCGGTCG
GCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTCTGC
CTCGGCTGCACCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCG
GGCCCCAGTGCCAGGAAAGGCAAGGGGCAGATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCG
GCGTGGTCAACATCCCTGCCGCAGAGTGCTTAGATGAGTACGAAGATGATGAAGCAGGGCAGAAAGAGCG
GAAACGAGAAGATGCAATTACACAACAGAACACTATACAGAATGAAGCTGTAAACTTACTAGATCCAGGC
AGTTCCTATCTGCTACAGGAGCCACCTAGAACAGTTTCAGGCAGATATAAAAGCACAACCAGTGTCTCTG
AAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTTCCCTAGATATAACAGGGATGCAAA
TGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGTAGTA
AGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCA
AAGAAGAAATTGATTTATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGA
AAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGACCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202733 protein sequence
Red=Cloning site Green=Tags(s)

MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN
NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS
GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG
SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV
RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002583
ORF Size 1020 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002583.4
RefSeq Size 1967 bp
RefSeq ORF 1023 bp
Locus ID 5074
UniProt ID Q96IZ0
Cytogenetics 12q21.2
Protein Families Druggable Genome, Transcription Factors
MW 36.6 kDa
Gene Summary This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.