G3BP(G3BP1) (NM_005754) Human Tagged ORF Clone

CAT#: RC202692

G3BP1 (Myc-DDK-tagged)-Human GTPase activating protein (SH3 domain) binding protein 1 (G3BP1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name G3BP(G3BP1) (NM_005754) Human Tagged ORF Clone
Symbol G3BP1
Synonyms G3BP; HDH-VIII
Vector pCMV6-Entry
Sequence Data
>RC202692 representing NM_005754
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGATGGAGAAGCCTAGTCCCCTGCTGGTCGGGCGGGAATTTGTGAGACAGTATTACACACTGCTGA
ACCAGGCCCCAGACATGCTGCATAGATTTTATGGAAAGAACTCTTCTTATGTCCATGGGGGATTGGATTC
AAATGGAAAGCCAGCAGATGCAGTCTACGGACAGAAAGAAATCCACAGGAAAGTGATGTCACAAAACTTC
ACCAACTGCCACACCAAGATTCGCCATGTTGATGCTCATGCCACGCTAAATGATGGTGTGGTAGTCCAGG
TGATGGGGCTTCTCTCTAACAACAACCAGGCTTTGAGGAGATTCATGCAAACGTTTGTCCTTGCTCCTGA
GGGGTCTGTTGCAAATAAATTCTATGTTCACAATGATATCTTCAGATACCAAGATGAGGTCTTTGGTGGG
TTTGTCACTGAGCCTCAGGAGGAGTCTGAAGAAGAAGTAGAGGAACCTGAAGAAAGACAGCAAACACCTG
AGGTGGTACCTGATGATTCTGGAACTTTCTATGATCAGGCAGTTGTCAGTAATGACATGGAAGAACATTT
AGAGGAGCCTGTTGCTGAACCAGAGCCTGATCCTGAACCAGAACCAGAACAAGAACCTGTATCTGAAATC
CAAGAGGAAAAGCCTGAGCCAGTATTAGAAGAAACTGCCCCTGAGGATGCTCAGAAGAGTTCTTCTCCAG
CACCTGCAGACATAGCTCAGACAGTACAGGAAGACTTGAGGACATTTTCTTGGGCATCTGTGACCAGTAA
GAATCTTCCACCCAGTGGAGCTGTTCCAGTTACTGGGATACCACCTCATGTTGTTAAAGTACCAGCTTCA
CAGCCCCGTCCAGAGTCTAAGCCTGAATCTCAGATTCCACCACAAAGACCTCAGCGGGATCAAAGAGTGC
GAGAACAACGAATAAATATTCCTCCCCAAAGGGGACCCAGACCAATCCGTGAGGCTGGTGAGCAAGGTGA
CATTGAACCCCGAAGAATGGTGAGACACCCTGACAGTCACCAACTCTTCATTGGCAACCTGCCTCATGAA
GTGGACAAATCAGAGCTTAAAGATTTCTTTCAAAGTTATGGAAACGTGGTGGAGTTGCGCATTAACAGTG
GTGGGAAATTACCCAATTTTGGTTTTGTTGTGTTTGATGATTCTGAGCCTGTTCAGAAAGTCCTTAGCAA
CAGGCCCATCATGTTCAGAGGTGAGGTCCGTCTGAATGTCGAAGAGAAGAAGACTCGAGCTGCCAGGGAA
GGCGACCGACGAGATAATCGCCTTCGGGGACCTGGAGGCCCTCGAGGTGGGCTGGGTGGTGGAATGAGAG
GCCCTCCCCGTGGAGGCATGGTGCAGAAACCAGGATTTGGAGTGGGAAGGGGGCTTGCGCCACGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202692 representing NM_005754
Red=Cloning site Green=Tags(s)

MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF
TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGG
FVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEI
QEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPAS
QPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHE
VDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE
GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005754
ORF Size 1398 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005754.1, NM_005754.2, NP_005745
RefSeq Size 2855
RefSeq ORF 1401
Locus ID 10146
Cytogenetics 5q33.1
Domains rrm, NTF2
Protein Families Druggable Genome
MW 52 kDa
Gene Summary This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (4)