MAD2L1 binding protein (MAD2L1BP) (NM_014628) Human Tagged ORF Clone

CAT#: RC202640

MAD2L1BP (Myc-DDK-tagged)-Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_014628" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


MAD2L1BP mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
    • 100 ul

USD 447.00

Other products for "MAD2L1 binding protein"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MAD2L1 binding protein
Synonyms CMT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202640 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCCGGAGGCGGAGGTTCTGTCCTCAGCCGCAGTCCCTGATTTGGAGTGGTATGAGAAGTCCG
AAGAAACTCACGCCTCCCAGATAGAACTACTTGAGACAAGCTCTACGCAGGAACCTCTCAACGCTTCGGA
GGCCTTTTGCCCAAGAGACTGCATGGTACCAGTGGTGTTTCCTGGGCCTGTGAGCCAGGAAGGCTGCTGT
CAGTTTACTTGTGAACTTCTAAAGCATATCATGTATCAACGCCAGCAGCTCCCTCTGCCCTATGAACAGC
TTAAGCACTTTTACCGAAAACCTTCTCCCCAGGCAGAGGAGATGCTGAAGAAGAAACCTCGGGCCACCAC
TGAGGTGAGCAGCAGGAAATGCCAACAAGCCCTGGCAGAACTGGAGAGTGTCCTCAGCCACCTGGAGGAC
TTCTTTGCACGGACACTAGTACCGCGAGTGCTGATTCTCCTTGGGGGCAATGCCCTAAGCCCCAAGGAGT
TCTATGAACTCGACTTGTCTCTGCTGGCCCCCTACAGCGTGGACCAGAGCCTGAGCACAGCAGCTTGTTT
GCGCCGTCTCTTCCGAGCCATATTCATGGCTGATGCCTTTAGCGAGCTTCAGGCTCCTCCACTCATGGGC
ACCGTCGTCATGGCACAGGGACACCGCAACTGTGGAGAAGATTGGTTTCGACCCAAGCTCAACTATCGAG
TGCCCAGCCGGGGCCATAAACTGACTGTGACCCTGTCATGTGGCAGACCTTCCATCCGAACCACGGCTTG
GGAAGACTACATTTGGTTCCAGGCACCAGTGACATTTAAAGGCTTCCGCGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202640 protein sequence
Red=Cloning site Green=Tags(s)

MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC
QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED
FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG
TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014628
ORF Size 822 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014628.3
RefSeq Size 1283 bp
RefSeq ORF 825 bp
Locus ID 9587
UniProt ID Q15013
Cytogenetics 6p21.1
Protein Families Druggable Genome
MW 31.1 kDa
Gene Summary The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.