DLX5 (NM_005221) Human Tagged ORF Clone

CAT#: RC202525

DLX5 (Myc-DDK-tagged)-Human distal-less homeobox 5 (DLX5)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DLX5 (NM_005221) Human Tagged ORF Clone
Symbol DLX5
Synonyms SHFM1D; SHFM1D
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202525 representing NM_005221
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGGAGTGTTTGACAGAAGGGTCCCCAGCATCCGATCCGGCGACTTCCAAGCTCCGTTCCAGACGT
CCGCAGCTATGCACCATCCGTCTCAGGAATCGCCAACTTTGCCCGAGTCTTCAGCTACCGATTCTGACTA
CTACAGCCCTACGGGGGGAGCCCCGCACGGCTACTGCTCTCCTACCTCGGCTTCCTATGGCAAAGCTCTC
AACCCCTACCAGTATCAGTATCACGGCGTGAACGGCTCCGCCGGGAGCTACCCAGCCAAAGCTTATGCCG
ACTATAGCTACGCTAGCTCCTACCACCAGTACGGCGGCGCCTACAACCGCGTCCCAAGCGCCACCAACCA
GCCAGAGAAAGAAGTGACCGAGCCCGAGGTGAGAATGGTGAATGGCAAACCAAAGAAAGTTCGTAAACCC
AGGACTATTTATTCCAGCTTTCAGCTGGCCGCATTACAGAGAAGGTTTCAGAAGACTCAGTACCTCGCCT
TGCCGGAACGCGCCGAGCTGGCCGCCTCGCTGGGATTGACACAAACACAGGTGAAAATCTGGTTTCAGAA
CAAAAGATCCAAGATCAAGAAGATCATGAAAAACGGGGAGATGCCCCCGGAGCACAGTCCCAGCTCCAGC
GACCCAATGGCGTGTAACTCGCCGCAGTCTCCAGCGGTGTGGGAGCCCCAGGGCTCGTCCCGCTCGCTCA
GCCACCACCCTCATGCCCACCCTCCGACCTCCAACCAGTCCCCAGCGTCCAGCTACCTGGAGAACTCTGC
ATCCTGGTACACAAGTGCAGCCAGCTCAATCAATTCCCACCTGCCGCCGCCGGGCTCCTTACAGCACCCG
CTGGCGCTGGCCTCCGGGACACTCTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202525 representing NM_005221
Red=Cloning site Green=Tags(s)

MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKAL
NPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
RTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSS
DPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHP
LALASGTLY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005221
ORF Size 867 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005221.1, NM_005221.2, NM_005221.3, NM_005221.4, NM_005221.5, NP_005212
RefSeq Size 1424
RefSeq ORF 870
Locus ID 1749
Cytogenetics 7q21.3
Domains homeobox
Protein Families ES Cell Differentiation/IPS, Transcription Factors
MW 31.4 kDa
Gene Summary This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)