CITED2 (NM_006079) Human Tagged ORF Clone

CAT#: RC202494

CITED2 (Myc-DDK-tagged)-Human Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 (CITED2), transcript variant 1

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CITED2 (NM_006079) Human Tagged ORF Clone
Symbol CITED2
Synonyms ASD8; MRG-1; MRG1; P35SRJ; VSD2
Vector pCMV6-Entry
Sequence Data
>RC202494 representing NM_006079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGACCATATGATGGCCATGAACCACGGGCGCTTCCCCGACGGCACCAATGGGCTGCACCATCACC
CTGCCCACCGCATGGGCATGGGGCAGTTCCCGAGCCCCCATCACCACCAGCAGCAGCAGCCCCAGCACGC
CTTCAACGCCCTAATGGGCGAGCACATACACTACGGCGCGGGCAACATGAATGCCACGAGCGGCATCAGG
CATGCGATGGGGCCGGGGACTGTGAACGGAGGGCACCCCCCGAGCGCGCTGGCCCCCGCGGCCAGGTTTA
ACAACTCCCAGTTCATGGGTCCCCCGGTGGCCAGCCAGGGAGGCTCCCTGCCGGCCAGCATGCAGCTGCA
GAAGCTCAACAACCAGTATTTCAACCATCACCCCTACCCCCACAACCACTACATGCCGGATTTGCACCCT
GCTGCAGGCCACCAGATGAACGGGACAAACCAGCACTTCCGAGATTGCAACCCCAAGCACAGCGGCGGCA
GCAGCACCCCCGGCGGCTCGGGCGGCAGCAGCACCCCCGGCGGCTCTGGCAGCAGCTCGGGCGGCGGCGC
GGGCAGCAGCAACAGCGGCGGCGGCAGCGGCAGCGGCAACATGCCCGCCTCCGTGGCCCACGTCCCCGCT
GCAATGCTGCCGCCCAATGTCATAGACACTGATTTCATCGACGAGGAAGTTCTTATGTCCTTGGTGATAG
AAATGGGTTTGGACCGCATCAAGGAGCTGCCCGAACTCTGGCTGGGGCAAAACGAGTTTGATTTTATGAC
GGACTTCGTGTGCAAACAGCAGCCCAGCAGAGTGAGCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202494 representing NM_006079
Red=Cloning site Green=Tags(s)

MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR
HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP
AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA
AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006079
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006079.2, NM_006079.3, NM_006079.4, NP_006070
RefSeq Size 1930
RefSeq ORF 813
Locus ID 10370
Cytogenetics 6q24.1
Domains CITED
Protein Families Transcription Factors, Druggable Genome
MW 28.3 kDa
Gene Summary The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)