Leukotriene B4 Receptor(LTB4R) (NM_181657) Human Tagged ORF Clone

CAT#: RC202433

LTB4R (Myc-DDK-tagged)-Human leukotriene B4 receptor (LTB4R), transcript variant 1

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Leukotriene B4 Receptor(LTB4R) (NM_181657) Human Tagged ORF Clone
Symbol LTB4R
Synonyms BLT1; BLTR; CMKRL1; GPR16; LTB4R1; LTBR1; P2RY7; P2Y7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202433 representing NM_181657
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACACTACATCTTCTGCAGCACCCCCCTCACTAGGTGTAGAGTTCATCTCTCTGCTGGCTATCATCC
TGCTGTCAGTGGCGCTGGCTGTGGGGCTTCCCGGCAACAGCTTTGTGGTGTGGAGTATCCTGAAAAGGAT
GCAGAAGCGCTCTGTCACTGCCCTGATGGTGCTGAACCTGGCCCTGGCCGACCTGGCCGTATTGCTCACT
GCTCCCTTTTTCCTTCACTTCCTGGCCCAAGGCACCTGGAGTTTTGGACTGGCTGGTTGCCGCCTGTGTC
ACTATGTCTGCGGAGTCAGCATGTACGCCAGCGTCCTGCTTATCACGGCCATGAGTCTAGACCGCTCACT
GGCGGTGGCCCGCCCCTTTGTGTCCCAGAAGCTACGCACCAAGGCGATGGCCCGGCGGGTGCTGGCAGGC
ATCTGGGTGTTGTCCTTTCTGCTGGCCACACCCGTCCTCGCGTACCGCACAGTAGTGCCCTGGAAAACGA
ACATGAGCCTGTGCTTCCCGCGGTACCCCAGCGAAGGGCACCGGGCCTTCCATCTAATCTTCGAGGCTGT
CACGGGCTTCCTGCTGCCCTTCCTGGCTGTGGTGGCCAGCTACTCGGACATAGGGCGTCGGCTACAGGCC
CGGCGCTTCCGCCGCAGCCGCCGCACCGGCCGCCTGGTGGTGCTCATCATCCTGACCTTCGCCGCCTTCT
GGCTGCCCTACCACGTGGTGAACCTGGCTGAGGCGGGCCGCGCGCTGGCCGGCCAGGCCGCCGGGTTAGG
GCTCGTGGGGAAGCGGCTGAGCCTGGCCCGCAACGTGCTCATCGCACTCGCCTTCCTGAGCAGCAGCGTG
AACCCCGTGCTGTACGCGTGCGCCGGCGGCGGCCTGCTGCGCTCGGCGGGCGTGGGCTTCGTCGCCAAGC
TGCTGGAGGGCACGGGCTCCGAGGCGTCCAGCACGCGCCGCGGGGGCAGCCTGGGCCAGACCGCTAGGAG
CGGCCCCGCCGCTCTGGAGCCCGGCCCTTCCGAGAGCCTCACTGCCTCCAGCCCTCTCAAGTTAAACGAA
CTGAACAGCGGACCG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202433 representing NM_181657
Red=Cloning site Green=Tags(s)

MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLT
APFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAG
IWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQA
RRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSV
NPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
LNSGP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_181657
ORF Size 1065 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_181657.1, NM_181657.2, NM_181657.3, NP_858043
RefSeq Size 3023
Locus ID 1241
Cytogenetics 14q12
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 37.4 kDa
Gene Summary Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations