Centrin 2 (CETN2) (NM_004344) Human Tagged ORF Clone

CAT#: RC202422

CETN2 (Myc-DDK-tagged)-Human centrin, EF-hand protein, 2 (CETN2)

Product Images

Circular map for RC202422

• 

  Western blot validation of overexpression lysate (Cat# LY418049) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202422 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Centrin 2
• Synonyms: CALT; CEN2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202422 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCTCCAACTTTAAGAAGGCAAACATGGCATCAAGTTCTCAGCGAAAAAGAATGAGCCCTAAGCCTG
  AGCTTACTGAAGAGCAAAAGCAGGAGATCCGGGAAGCTTTTGATCTTTTCGATGCGGATGGAACTGGCAC
  CATAGATGTTAAAGAACTGAAGGTGGCAATGAGGGCCCTGGGCTTTGAACCCAAGAAAGAAGAAATTAAG
  AAAATGATAAGTGAAATTGATAAGGAAGGGACAGGAAAAATGAACTTTGGTGACTTTTTAACTGTGATGA
  CCCAGAAAATGTCTGAGAAAGATACTAAAGAAGAAATCCTGAAAGCTTTCAAGCTCTTTGATGATGATGA
  AACTGGGAAGATTTCGTTCAAAAATCTGAAACGCGTGGCCAAGGAGTTGGGTGAGAACCTGACTGATGAG
  GAGCTGCAGGAAATGATTGATGAAGCTGATCGAGATGGAGATGGAGAGGTCAGTGAGCAAGAGTTCCTGC
  GCATCATGAAAAAGACCAGCCTCTAT
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202422 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIK
  KMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE
  ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_004344
• ORF Size: 516 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_004344.3
• RefSeq Size: 1087 bp
• RefSeq ORF: 519 bp
• Locus ID: 1069
• UniProt ID: P41208
• Cytogenetics: Xq28
• Domains: EFh
• Protein Families: Druggable Genome
• Protein Pathways: Nucleotide excision repair
• MW: 19.7 kDa
• Gene Summary: Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008]