CTCF (NM_006565) Human Tagged ORF Clone

CAT#: RC202416

Reviews ()
Write a review

CTCF (Myc-DDK-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1



  "NM_006565" in other vectors (7)

Reconstitution Protocol

USD 665.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CTCF"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CTCF
Synonyms CFAP108; FAP108; MRD21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202416 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGTGATGCAGTCGAAGCCATTGTGGAGGAGTCCGAAACTTTTATTAAAGGAAAGGAGAGAAAGA
CTTACCAGAGACGCCGGGAAGGGGGCCAGGAAGAAGATGCCTGCCACTTACCCCAGAACCAGACGGATGG
GGGTGAGGTGGTCCAGGATGTCAACAGCAGTGTACAGATGGTGATGATGGAACAGCTGGACCCCACCCTT
CTTCAGATGAAGACTGAAGTAATGGAGGGCACAGTGGCTCCAGAAGCAGAGGCTGCTGTGGACGATACCC
AGATTATAACTTTACAGGTTGTAAATATGGAGGAACAGCCCATAAACATAGGAGAACTTCAGCTTGTTCA
AGTACCTGTTCCTGTGACTGTACCTGTTGCTACCACTTCAGTAGAAGAACTTCAGGGGGCTTATGAAAAT
GAAGTGTCTAAAGAGGGCCTTGCGGAAAGTGAACCCATGATATGCCACACCCTACCTTTGCCTGAAGGGT
TTCAGGTGGTTAAAGTGGGGGCCAATGGAGAGGTGGAGACACTAGAACAAGGGGAACTTCCACCCCAGGA
AGATCCTAGTTGGCAAAAAGACCCAGACTATCAGCCACCAGCCAAAAAAACAAAGAAAACCAAAAAGAGC
AAACTGCGTTATACAGAGGAGGGCAAAGATGTAGATGTGTCTGTCTACGATTTTGAGGAAGAACAGCAGG
AGGGTCTGCTATCAGAGGTTAATGCAGAGAAAGTGGTTGGTAATATGAAGCCTCCAAAGCCAACAAAAAT
TAAAAAGAAAGGTGTAAAGAAGACATTCCAGTGTGAGCTTTGCAGTTACACGTGTCCACGGCGTTCAAAT
TTGGATCGTCACATGAAAAGCCACACTGATGAGAGACCACACAAGTGCCATCTCTGTGGCAGGGCATTCA
GAACAGTCACCCTCCTGAGGAATCACCTTAACACACACACAGGTACTCGTCCTCACAAGTGCCCAGACTG
CGACATGGCCTTTGTGACCAGTGGAGAATTGGTTCGGCATCGTCGTTACAAACACACCCACGAGAAGCCA
TTCAAGTGTTCCATGTGCGATTACGCCAGTGTAGAAGTCAGCAAATTAAAACGTCACATTCGCTCTCATA
CTGGAGAGCGTCCGTTTCAGTGCAGTTTGTGCAGTTATGCCAGCAGGGACACATACAAGCTGAAAAGGCA
CATGAGAACCCATTCAGGGGAAAAGCCTTATGAATGTTATATTTGTCATGCTCGGTTTACCCAAAGTGGT
ACCATGAAGATGCACATTTTACAGAAGCACACAGAAAATGTGGCCAAATTTCACTGTCCCCACTGTGACA
CAGTCATAGCCCGAAAAAGTGATTTGGGTGTCCACTTGCGAAAGCAGCATTCCTATATTGAGCAAGGCAA
GAAATGCCGTTACTGTGATGCTGTGTTTCATGAGCGCTATGCCCTCATCCAGCATCAGAAGTCACACAAG
AATGAGAAGCGCTTTAAGTGTGACCAGTGTGATTACGCTTGTAGACAGGAGAGGCACATGATCATGCACA
AGCGCACCCACACCGGGGAGAAGCCTTACGCCTGCAGCCACTGCGATAAGACCTTCCGCCAGAAGCAGCT
TCTCGACATGCACTTCAAGCGCTATCACGACCCCAACTTCGTCCCTGCGGCTTTTGTCTGTTCTAAGTGT
GGGAAAACATTTACACGTCGGAATACCATGGCAAGACATGCTGATAATTGTGCTGGCCCAGATGGCGTAG
AGGGGGAAAATGGAGGAGAAACGAAGAAGAGTAAACGTGGAAGAAAAAGAAAGATGCGCTCTAAGAAAGA
AGATTCCTCTGACAGTGAAAATGCTGAACCAGATCTGGACGACAATGAGGATGAGGAGGAGCCTGCCGTA
GAAATTGAACCTGAGCCAGAGCCTCAGCCTGTGACCCCAGCCCCACCACCCGCCAAGAAGCGGAGAGGAC
GACCCCCTGGCAGAACCAACCAGCCCAAACAGAACCAGCCAACAGCTATCATTCAGGTTGAAGACCAGAA
TACAGGTGCAATTGAGAACATTATAGTTGAAGTAAAAAAAGAGCCAGATGCTGAGCCCGCAGAGGGAGAG
GAAGAGGAGGCCCAGCCAGCTGCCACAGATGCCCCCAACGGAGACCTCACGCCCGAGATGATCCTCAGCA
TGATGGACCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202416 protein sequence
Red=Cloning site Green=Tags(s)

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTL
LQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYEN
EVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKS
KLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSN
LDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKP
FKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHK
NEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKC
GKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAV
EIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGE
EEEAQPAATDAPNGDLTPEMILSMMDR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006565
ORF Size 2181 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006565.4
RefSeq Size 3946 bp
RefSeq ORF 2184 bp
Locus ID 10664
UniProt ID P49711
Cytogenetics 16q22.1
Domains zf-C2H2
Protein Families Transcription Factors
MW 82.8 kDa
Gene Summary This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.