DYRK2 (NM_003583) Human Tagged ORF Clone

CAT#: RC202413

DYRK2 (Myc-DDK-tagged)-Human dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (DYRK2), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DYRK2 (NM_003583) Human Tagged ORF Clone
Symbol DYRK2
Synonyms FLJ21217; FLJ21365
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202413 representing NM_003583
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGATCACCTGCATGTCGGCAGCCACGCTCACGGACAGATCCAGGTTCAACAGTTGTTTGAGGATA
ACAGTAACAAGCGGACAGTGCTCACGACACAACCAAATGGGCTTACAACAGTGGGCAAAACGGGCTTGCC
AGTGGTGCCAGAGCGGCAGCTGGACAGCATTCATAGACGGCAGGGGAGCTCCACCTCTCTAAAGTCCATG
GAAGGCATGGGGAAGGTGAAAGCCACCCCCATGACACCTGAACAAGCAATGAAGCAATACATGCAAAAAC
TCACAGCCTTCGAACACCATGAGATTTTCAGCTACCCTGAAATATATTTCTTGGGTCTAAATGCTAAGAA
GCGCCAGGGCATGACAGGTGGGCCCAACAATGGTGGCTATGATGATGACCAGGGATCATATGTGCAGGTG
CCCCACGATCACGTGGCTTACAGGTATGAGGTCCTCAAGGTCATTGGGAAGGGGAGCTTTGGGCAGGTGG
TCAAGGCCTACGATCACAAAGTCCACCAGCACGTGGCCCTAAAGATGGTGCGGAATGAGAAGCGCTTCCA
CCGGCAAGCAGCGGAGGAGATCCGAATCCTGGAACACCTGCGGAAGCAGGACAAGGATAACACAATGAAT
GTCATCCATATGCTGGAGAATTTCACCTTCCGCAACCACATCTGCATGACGTTTGAGCTGCTGAGCATGA
ACCTCTATGAGCTCATCAAGAAGAATAAATTCCAGGGCTTCAGTCTGCCTTTGGTTCGCAAGTTTGCCCA
CTCGATTCTGCAGTGCTTGGATGCTTTGCACAAAAACAGAATAATTCACTGTGACCTTAAGCCCGAGAAC
ATTTTGTTAAAGCAGCAGGGTAGAAGCGGTATTAAAGTAATTGATTTTGGCTCCAGTTGTTACGAGCATC
AGCGTGTCTACACGTACATCCAGTCGCGTTTTTACCGGGCTCCAGAAGTGATCCTTGGGGCCAGGTATGG
CATGCCCATTGATATGTGGAGCCTGGGCTGCATTTTAGCAGAGCTCCTGACGGGTTACCCCCTCTTGCCT
GGGGAAGATGAAGGGGACCAGCTGGCCTGTATGATTGAACTGTTGGGCATGCCCTCACAGAAACTGCTGG
ATGCATCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGTTATCCCCGTTACTGCACTGTCACGACTCT
CTCAGATGGCTCTGTGGTCCTAAACGGAGGCCGTTCCCGGAGGGGGAAACTGAGGGGCCCACCGGAGAGC
AGAGAGTGGGGTAACGCGCTGAAGGGGTGTGATGATCCCCTTTTCCTTGACTTCTTAAAACAGTGTTTAG
AGTGGGATCCTGCAGTGCGCATGACCCCAGGCCAGGCTTTGCGGCACCCCTGGCTGAGGAGGCGGTTGCC
AAAGCCTCCCACCGGGGAGAAAACGTCAGTGAAAAGGATAACTGAGAGCACCGGTGCTATCACATCTATA
TCCAAGTTACCTCCACCTTCTAGCTCAGCTTCCAAACTGAGGACTAATTTGGCGCAGATGACAGATGCCA
ATGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTTAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202413 representing NM_003583
Red=Cloning site Green=Tags(s)

MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSM
EGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQV
PHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMN
VIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPEN
ILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLP
GEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPES
REWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSI
SKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003583
ORF Size 1584 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003583.1, NM_003583.2, NM_003583.3, NP_003574
RefSeq Size 3466
RefSeq ORF 1587
Locus ID 8445
Cytogenetics 12q15
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
MW 59.5 kDa
Gene Summary DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations