STARD5 (NM_181900) Human Tagged ORF Clone

CAT#: RC202407

Reviews ()
Write a review

STARD5 (Myc-DDK-tagged)-Human StAR-related lipid transfer (START) domain containing 5 (STARD5)



  "NM_181900" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 300.00

USD 450.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "STARD5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol STARD5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202407 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCGGCGCTGGCAGCCCAGATGAGCGAGGCTGTGGCCGAGAAGATGCTCCAGTACCGGCGGGACA
CAGCAGGCTGGAAGATTTGCCGGGAAGGCAATGGAGTTTCAGTTTCCTGGAGGCCATCTGTGGAGTTTCC
AGGGAACCTGTACCGAGGAGAAGGCATTGTATATGGGACACTAGAGGAGGTGTGGGACTGTGTGAAGCCA
GCTGTTGGAGGCCTACGAGTGAAGTGGGATGAGAATGTGACCGGTTTTGAAATTATCCAAAGCATCACTG
ACACCCTGTGTGTAAGCAGAACCTCCACTCCCTCCGCTGCCATGAAGCTCATTTCTCCCAGAGATTTTGT
GGACTTGGTGCTAGTCAAGAGATATGAGGATGGGACCATCAGTTCCAACGCCACCCATGTGGAGCATCCG
TTATGTCCCCCGAAGCCAGGTTTTGTGAGAGGATTTAACCATCCTTGTGGTTGCTTCTGTGAACCTCTTC
CAGGGGAACCCACCAAGACCAACCTGGTCACATTCTTCCATACCGACCTCAGCGGTTACCTCCCACAGAA
CGTGGTGGACTCCTTCTTCCCCCGCAGCATGACCCGGTTTTATGCCAACCTTCAGAAAGCAGTGAAGCAA
TTCCATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202407 protein sequence
Red=Cloning site Green=Tags(s)

MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP
AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP
LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ
FHE

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_181900
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_181900.3
RefSeq Size 1344 bp
RefSeq ORF 642 bp
Locus ID 80765
UniProt ID Q9NSY2
Cytogenetics 15q25.1
MW 23.8 kDa
Gene Summary Proteins containing a steroidogenic acute regulatory-related lipid transfer (START) domain are often involved in the trafficking of lipids and cholesterol between diverse intracellular membranes. This gene is a member of the StarD subfamily that encodes START-related lipid transfer proteins. The protein encoded by this gene is a cholesterol transporter and is also able to bind and transport other sterol-derived molecules related to the cholesterol/bile acid biosynthetic pathways such as 25-hydroxycholesterol. Its expression is upregulated during endoplasmic reticulum (ER) stress. The protein is thought to act as a cytosolic sterol transporter that moves cholesterol between intracellular membranes such as from the cytoplasm to the ER and from the ER to the Golgi apparatus. Alternative splicing of this gene produces multiple transcript variants. [provided by RefSeq, Jan 2016]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.