STARD5 (NM_181900) Human Tagged ORF Clone

CAT#: RC202407

STARD5 (Myc-DDK-tagged)-Human StAR-related lipid transfer (START) domain containing 5 (STARD5)

Product Images

Western blot validation of overexpression lysate (Cat# LY405583) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202407 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified STARD5 protein (Cat# TP302407). The protein was produced from HEK293T cells transfected with STARD5 cDNA clone (Cat# RC202407) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: STARD5
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202407 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACCCGGCGCTGGCAGCCCAGATGAGCGAGGCTGTGGCCGAGAAGATGCTCCAGTACCGGCGGGACA
  CAGCAGGCTGGAAGATTTGCCGGGAAGGCAATGGAGTTTCAGTTTCCTGGAGGCCATCTGTGGAGTTTCC
  AGGGAACCTGTACCGAGGAGAAGGCATTGTATATGGGACACTAGAGGAGGTGTGGGACTGTGTGAAGCCA
  GCTGTTGGAGGCCTACGAGTGAAGTGGGATGAGAATGTGACCGGTTTTGAAATTATCCAAAGCATCACTG
  ACACCCTGTGTGTAAGCAGAACCTCCACTCCCTCCGCTGCCATGAAGCTCATTTCTCCCAGAGATTTTGT
  GGACTTGGTGCTAGTCAAGAGATATGAGGATGGGACCATCAGTTCCAACGCCACCCATGTGGAGCATCCG
  TTATGTCCCCCGAAGCCAGGTTTTGTGAGAGGATTTAACCATCCTTGTGGTTGCTTCTGTGAACCTCTTC
  CAGGGGAACCCACCAAGACCAACCTGGTCACATTCTTCCATACCGACCTCAGCGGTTACCTCCCACAGAA
  CGTGGTGGACTCCTTCTTCCCCCGCAGCATGACCCGGTTTTATGCCAACCTTCAGAAAGCAGTGAAGCAA
  TTCCATGAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202407 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP
  AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP
  LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ
  FHE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_181900
• ORF Size: 639 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_181900.3
• RefSeq Size: 1344 bp
• RefSeq ORF: 642 bp
• Locus ID: 80765
• UniProt ID: Q9NSY2
• Cytogenetics: 15q25.1
• MW: 23.8 kDa
• Gene Summary: Proteins containing a steroidogenic acute regulatory-related lipid transfer (START) domain are often involved in the trafficking of lipids and cholesterol between diverse intracellular membranes. This gene is a member of the StarD subfamily that encodes START-related lipid transfer proteins. The protein encoded by this gene is a cholesterol transporter and is also able to bind and transport other sterol-derived molecules related to the cholesterol/bile acid biosynthetic pathways such as 25-hydroxycholesterol. Its expression is upregulated during endoplasmic reticulum (ER) stress. The protein is thought to act as a cytosolic sterol transporter that moves cholesterol between intracellular membranes such as from the cytoplasm to the ER and from the ER to the Golgi apparatus. Alternative splicing of this gene produces multiple transcript variants. [provided by RefSeq, Jan 2016]