ARFGAP3 (NM_014570) Human Tagged ORF Clone

CAT#: RC202392

Reviews ()
Write a review

ARFGAP3 (Myc-DDK-tagged)-Human ADP-ribosylation factor GTPase activating protein 3 (ARFGAP3), transcript variant 1



  "NM_014570" in other vectors (5)

Reconstitution Protocol

USD 480.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "ARFGAP3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ARFGAP3
Synonyms ARFGAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202392 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGACCCCAGCAAGCAGGACATCTTGACCATCTTCAAGCGCCTCCGCTCGGTGCCCACTAACAAGG
TGTGTTTTGATTGTGGTGCCAAAAATCCCAGCTGGGCAAGCATAACCTATGGAGTGTTCCTTTGCATTGA
TTGCTCAGGGTCCCACCGGTCACTTGGTGTTCACTTGAGTTTTATTCGATCTACAGAGTTGGATTCCAAC
TGGTCATGGTTTCAGTTGCGATGCATGCAAGTCGGAGGAAACGCTAGTGCATCTTCCTTTTTTCATCAAC
ATGGGTGTTCCACCAATGACACCAATGCCAAGTACAACAGTCGTGCTGCTCAGCTCTATAGGGAGAAAAT
CAAATCGCTCGCCTCTCAAGCAACACGGAAGCATGGCACTGATCTGTGGCTTGATAGTTGTGTGGTTCCA
CCTTTGTCCCCTCCACCAAAGGAGGAAGATTTTTTTGCCTCTCACGTTTCTCCTGAGGTGAGTGACACAG
CGTGGGCATCAGCAATAGCAGAACCATCTTCTTTAACATCAAGGCCTGTGGAAACCACTTTGGAAAATAA
TGAAGGTGGACAAGAGCAAGGACCAAGTGTGGAAGGTCTTAATGTACCAACAAAGGCTACTTTAGAGGTA
TCCTCTATCATAAAAAAGAAACCAAATCAAGCTAAAAAAGGCCTTGGGGCCAAAAAAGGAAGTTTGGGAG
CTCAGAAACTGGCAAACACATGCTTTAATGAAATTGAAAAACAAGCTCAAGCTGCGGATAAAATGAAGGA
GCAGGAAGACCTGGCCAAGGTGGTATCTAAAGAAGAATCAATTGTTTCATCATTACGATTAGCCTATAAG
GATCTTGAAATTCAAATGAAGAAAGACGAAAAGATGAACATTAGTGGCAAAAAAAATGTTGACTCAGACA
GACTCGGCATGGGATTTGGAAATTGCAGAAGTGTTATTTCACATTCAGTGACTTCAGATATGCAGACCAT
AGAGCAGGAATCACCCATTATGGCAAAACCAAGAAAAAAGTATAATGATGACAGTGACGATTCATATTTT
ACTTCCAGCTCAAGGTACTTTGACGAGCCAGTGGAGTTAAGGAGCAGTTCTTTCTCTAGCTGGGATGACA
GTTCAGATTCCTATTGGAAAAAAGAGACCAGCAAAGATACTGAAACAGTTCTGAAAACCACAGGCTATTC
AGACAGACCTACTGCTCGCCGCAAGCCAGATTATGAGCCAGTTGAAAATACAGATGAGGCCCAGAAGAAG
TTTGGCAATGTCAAGGCCATTTCATCAGATATGTATTTTGGAAGACAATCCCAGGCTGATTATGAGACCA
GGGCCCGCCTAGAGAGGCTGTCAGCAAGTTCCTCCATAAGCTCGGCTGATCTGTTCGAGGAGCCGAGGAA
GCAGCCAGCAGGGAACTACAGCCTGTCCAGCGTGCTGCCCAACGCCCCCGACATGGCGCAGTTCAAGCAG
GGAGTGAGATCGGTTGCTGGAAAACTCTCCGTCTTTGCTAATGGAGTCGTGACTTCAATTCAGGATCGCT
ACGGTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202392 protein sequence
Red=Cloning site Green=Tags(s)

MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSN
WSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP
PLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEV
SSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYK
DLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYF
TSSSRYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQ
GVRSVAGKLSVFANGVVTSIQDRYGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014570
ORF Size 1548 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014570.2
RefSeq Size 2851 bp
RefSeq ORF 1551 bp
Locus ID 26286
UniProt ID Q9NP61
Cytogenetics 22q13.2
Domains ArfGap
Protein Pathways Endocytosis
MW 57 kDa
Gene Summary The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene. [provided by RefSeq, Nov 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.