SLUG (SNAI2) (NM_003068) Human Tagged ORF Clone

CAT#: RC202365

Reviews ()
Write a review

SNAI2 (Myc-DDK-tagged)-Human snail homolog 2 (Drosophila) (SNAI2)



Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SNAI2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SNAI2
Synonyms SLUG; SLUGH; SLUGH1; SNAIL2; WS2D
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202365 representing NM_003068
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCGCTCCTTCCTGGTCAAGAAGCATTTCAACGCCTCCAAAAAGCCAAACTACAGCGAACTGGACA
CACATACAGTGATTATTTCCCCGTATCTCTATGAGAGTTACTCCATGCCTGTCATACCACAACCAGAGAT
CCTCAGCTCAGGAGCATACAGCCCCATCACTGTGTGGACTACCGCTGCTCCATTCCACGCCCAGCTACCC
AATGGCCTCTCTCCTCTTTCCGGATACTCCTCATCTTTGGGGCGAGTGAGTCCCCCTCCTCCATCTGACA
CCTCCTCCAAGGACCACAGTGGCTCAGAAAGCCCCATTAGTGATGAAGAGGAAAGACTACAGTCCAAGCT
TTCAGACCCCCATGCCATTGAAGCTGAAAAGTTTCAGTGCAATTTATGCAATAAGACCTATTCAACTTTT
TCTGGGCTGGCCAAACATAAGCAGCTGCACTGCGATGCCCAGTCTAGAAAATCTTTCAGCTGTAAATACT
GTGACAAGGAATATGTGAGCCTGGGCGCCCTGAAGATGCATATTCGGACCCACACATTACCTTGTGTTTG
CAAGATCTGCGGCAAGGCGTTTTCCAGACCCTGGTTGCTTCAAGGACACATTAGAACTCACACGGGGGAG
AAGCCTTTTTCTTGCCCTCACTGCAACAGAGCATTTGCAGACAGGTCAAATCTGAGGGCTCATCTGCAGA
CCCATTCTGATGTAAAGAAATACCAGTGCAAAAACTGCTCCAAAACCTTCTCCAGAATGTCTCTCCTGCA
CAAACATGAGGAATCTGGCTGCTGTGTAGCACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202365 representing NM_003068
Red=Cloning site Green=Tags(s)

MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLP
NGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTF
SGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGE
KPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003068
ORF Size 804 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003068.5
RefSeq Size 2101 bp
RefSeq ORF 807 bp
Locus ID 6591
UniProt ID O43623
Cytogenetics 8q11.21
Domains zf-C2H2
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Adherens junction
MW 29.8 kDa
Gene Summary This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.