FEZ1 (NM_005103) Human Tagged ORF Clone

CAT#: RC202344

FEZ1 (Myc-DDK-tagged)-Human fasciculation and elongation protein zeta 1 (zygin I) (FEZ1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FEZ1 (NM_005103) Human Tagged ORF Clone
Symbol FEZ1
Synonyms zygin 1; fasciculation and elongation protein zeta 1 (zygin I)
Vector pCMV6-Entry
Sequence Data
>RC202344 representing NM_005103
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCCCACTGGTGAGTCTGGATGAAGAGTTTGAGGACCTTCGACCCTCCTGCTCGGAGGACCCGG
AGGAGAAGCCCCAGTGTTTCTATGGTTCATCTCCCCACCATCTCGAGGACCCCTCCCTCTCCGAGCTTGA
GAATTTTTCTTCCGAAATAATCAGCTTCAAGTCCATGGAGGACCTCGTAAATGAATTTGATGAGAAGCTC
AATGTCTGCTTTCGGAACTACAACGCCAAGACCGAGAACCTAGCTCCCGTGAAGAACCAGTTACAGATCC
AAGAGGAGGAGGAGACCCTTCAGGACGAGGAGGTTTGGGATGCTCTGACAGACAATTACATCCCTTCACT
CTCAGAAGACTGGAGGGATCCAAACATCGAGGCTCTGAATGGCAACTGCTCTGACACTGAGATCCATGAG
AAAGAAGAGGAAGAGTTCAATGAGAAGAGTGAAAATGATTCCGGTATCAACGAGGAGCCTCTGCTCACAG
CAGATCAGGTAATTGAGGAGATTGAGGAAATGATGCAGAACTCCCCAGACCCTGAGGAAGAAGAGGAGGT
TCTGGAAGAAGAGGATGGAGGAGAAACTTCCTCCCAGGCAGACTCGGTCCTCCTGCAGGAGATGCAGGCA
TTGACACAGACCTTCAACAACAACTGGTCCTATGAAGGGCTGAGGCACATGTCTGGGTCTGAGCTGACCG
AGCTGCTGGACCAGGTGGAGGGTGCCATCCGTGACTTCTCGGAGGAGCTGGTGCAGCAGCTGGCCCGCCG
GGACGAGCTGGAGTTTGAGAAGGAAGTGAAGAACTCCTTTATCACGGTGCTTATTGAGGTTCAGAACAAG
CAGAAGGAGCAGCGAGAACTGATGAAAAAGAGGCGGAAAGAGAAAGGGCTGAGCCTGCAGAGCAGCCGGA
TAGAGAAGGGAAACCAGATGCCTCTCAAGCGCTTCAGCATGGAAGGCATCTCCAACATTCTGCAGAGTGG
CATCCGCCAGACCTTTGGCTCCTCAGGAACTGACAAACAGTATCTGAACACAGTCATTCCTTACGAGAAG
AAAGCCTCTCCTCCCTCAGTGGAAGACCTGCAGATGCTGACAAACATTCTCTTTGCCATGAAGGAGGATA
ATGAGAAGGTGCCTACTTTGCTAACGGACTACATTTTAAAAGTGCTCTGCCCTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202344 representing NM_005103
Red=Cloning site Green=Tags(s)

MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKL
NVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHE
KEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQA
LTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNK
QKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK
KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005103
ORF Size 1176 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005103.1, NM_005103.2, NM_005103.3, NM_005103.4, NP_005094
RefSeq Size 1702
RefSeq ORF 1179
Locus ID 9638
Cytogenetics 11q24.2
MW 44.9 kDa
Gene Summary This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)