RNPC3 (NM_017619) Human Tagged ORF Clone

CAT#: RC202319

Reviews ()
Write a review

RNPC3 (Myc-DDK-tagged)-Human RNA-binding region (RNP1, RRM) containing 3 (RNPC3)



  "NM_017619" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RNPC3
Synonyms IGHD5; RBM40; RNP; SNRNP65
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202319 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCTCCCGAGCAGCCGCTTGCGATATCAAGGGGATGCACGAGCTCCTCCTCGCTTTCCCCGCCTC
GGGGCGACCGAACCCTTCTGGTCAGGCACCTGCCGGCTGAGCTTACTGCTGAGGAGAAAGAGGACTTGCT
GAAGTACTTCGGGGCTCAGTCTGTGCGGGTCCTGTCAGATAAGGGGCGACTGAAACATACAGCTTTTGCC
ACATTCCCTAATGAAAAAGCAGCTATAAAGGCATTGACAAGACTCCATCAACTGAAACTTTTAGGTCATA
CTTTAGTCGTTGAATTTGCAAAAGAGCAAGATCGAGTTCACTCCCCATGTCCCACTTCAGGCTCTGAAAA
AAAAAAAAGGTCTGATGACCCTGTCGAAGATGATAAAGAAAAAAAAGAACTTGGTTATTTAACAGTAGAA
AATGGAATTGCACCAAACCATGGGCTGACTTTTCCTTTAAATTCATGCCTCAAGTATATGTACCCACCAC
CTTCCAGCACAATCCTAGCAAACATTGTAAATGCCTTGGCAAGCGTGCCTAAGTTCTATGTACAGGTCCT
TCATCTTATGAATAAAATGAATTTGCCCACACCTTTTGGACCAATTACTGCGCGACCTCCCATGTATGAA
GACTATATGCCATTGCATGCACCTCTTCCACCCACATCTCCTCAGCCACCTGAGGAACCTCCTTTGCCAG
ACGAGGATGAGGAATTATCTAGTGAAGAATCAGAATATGAAAGCACTGATGATGAGGACCGACAGAGAAT
GAACAAATTAATGGAACTAGCAAATCTTCAGCCCAAAAGACCTAAAACAATAAAGCAGCGCCATGTGAGA
AAAAAGAGAAAAATAAAGGATATGTTGAATACACCTTTGTGTCCTTCACACAGCAGTTTACATCCAGTGC
TGTTACCTTCAGATGTATTTGACCAACCACAACCTGTAGGTAACAAAAGAATTGAATTCCATATATCTAC
CGACATGCCAGCTGCATTTAAGAAAGATTTAGAAAAGGAACAAAATTGTGAGGAAAAAAATCATGATTTA
CCTGCTACTGAAGTTGATGCATCCAATATAGGATTTGGAAAAATCTTCCCCAAACCTAATTTGGACATCA
CAGAGGAGATTAAAGAAGACTCTGATGAAATGCCTTCAGAATGTATTTCTAGAAGGGAATTGGAAAAGGG
CAGAATTTCTAGAGAAGAAATGGAAACACTTTCAGTTTTCAGAAGTTATGAACCGGGTGAACCAAACTGT
AGAATTTATGTAAAGAATTTAGCTAAACATGTTCAAGAAAAGGACCTTAAATATATTTTTGGAAGATATG
TTGACTTTTCATCAGAAACACAGCGGATCATGTTTGATATACGTTTGATGAAAGAAGGTCGTATGAAAGG
ACAAGCTTTCATTGGACTTCCTAATGAAAAAGCAGCAGCAAAAGCCTTAAAGGAAGCTAATGGATATGTG
CTTTTTGGAAAACCCATGGTGGTTCAGTTTGCTCGATCTGCTAGACCAAAACAAGATCCTAAGGAAGGAA
AAAGAAAGTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202319 protein sequence
Red=Cloning site Green=Tags(s)

MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTAFA
TFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDRVHSPCPTSGSEKKKRSDDPVEDDKEKKELGYLTVE
NGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVPKFYVQVLHLMNKMNLPTPFGPITARPPMYE
DYMPLHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELANLQPKRPKTIKQRHVR
KKRKIKDMLNTPLCPSHSSLHPVLLPSDVFDQPQPVGNKRIEFHISTDMPAAFKKDLEKEQNCEEKNHDL
PATEVDASNIGFGKIFPKPNLDITEEIKEDSDEMPSECISRRELEKGRISREEMETLSVFRSYEPGEPNC
RIYVKNLAKHVQEKDLKYIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFIGLPNEKAAAKALKEANGYV
LFGKPMVVQFARSARPKQDPKEGKRKC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017619
ORF Size 1551 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017619.4
RefSeq Size 1901 bp
RefSeq ORF 1554 bp
Locus ID 55599
UniProt ID Q96LT9
Cytogenetics 1p21.1
MW 58.6 kDa
Gene Summary Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 65K protein that is a component of the U12-type spliceosome. This protein contains two RNA recognition motifs (RRMs), suggesting that it may contact one of the small nuclear RNAs of the minor spliceosome. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "RNPC3"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-RNPC3 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.