Cytochrome P450 Reductase(POR) (NM_000941) Human Tagged ORF Clone

CAT#: RC202172

POR (Myc-DDK-tagged)-Human P450 (cytochrome) oxidoreductase (POR)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cytochrome P450 Reductase(POR) (NM_000941) Human Tagged ORF Clone
Symbol POR
Synonyms CPR; CYPOR; P450R
Vector pCMV6-Entry
Sequence Data
>RC202172 representing NM_000941
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAACATGGGAGACTCCCACGTGGACACCAGCTCCACCGTGTCCGAGGCGGTGGCCGAAGAAGTAT
CTCTTTTCAGCATGACGGACATGATTCTGTTTTCGCTCATCGTGGGTCTCCTAACCTACTGGTTCCTCTT
CAGAAAGAAAAAAGAAGAAGTCCCCGAGTTCACCAAAATTCAGACATTGACCTCCTCTGTCAGAGAGAGC
AGCTTTGTGGAAAAGATGAAGAAAACGGGGAGGAACATCATCGTGTTCTACGGCTCCCAGACGGGGACTG
CAGAGGAGTTTGCCAACCGCCTGTCCAAGGACGCCCACCGCTACGGGATGCGAGGCATGTCAGCGGACCC
TGAGGAGTATGACCTGGCCGACCTGAGCAGCCTGCCAGAGATCGACAACGCCCTGGTGGTTTTCTGCATG
GCCACCTACGGTGAGGGAGACCCCACCGACAATGCCCAGGACTTCTACGACTGGCTGCAGGAGACAGACG
TGGATCTCTCTGGGGTCAAGTTCGCGGTGTTTGGTCTTGGGAACAAGACCTACGAGCACTTCAATGCCAT
GGGCAAGTACGTGGACAAGCGGCTGGAGCAGCTCGGCGCCCAGCGCATCTTTGAGCTGGGGTTGGGCGAC
GACGATGGGAACTTGGAGGAGGACTTCATCACCTGGCGAGAGCAGTTCTGGCTGGCCGTGTGTGAACACT
TTGGGGTGGAAGCCACTGGCGAGGAGTCCAGCATTCGCCAGTACGAGCTTGTGGTCCACACCGACATAGA
TGCGGCCAAGGTGTACATGGGGGAGATGGGCCGGCTGAAGAGCTACGAGAACCAGAAGCCCCCCTTTGAT
GCCAAGAATCCGTTCCTGGCTGCAGTCACCACCAACCGGAAGCTGAACCAGGGAACCGAGCGCCACCTCA
TGCACCTGGAATTGGACATCTCGGACTCCAAAATCAGGTATGAATCTGGGGACCACGTGGCTGTGTACCC
AGCCAACGACTCTGCTCTCGTCAACCAGCTGGGCAAAATCCTGGGTGCCGACCTGGACGTCGTCATGTCC
CTGAACAACCTGGATGAGGAGTCCAACAAGAAGCACCCATTCCCGTGCCCTACGTCCTACCGCACGGCCC
TCACCTACTACCTGGACATCACCAACCCGCCGCGTACCAACGTGCTGTACGAGCTGGCGCAGTACGCCTC
GGAGCCCTCGGAGCAGGAGCTGCTGCGCAAGATGGCCTCCTCCTCCGGCGAGGGCAAGGAGCTGTACCTG
AGCTGGGTGGTGGAGGCCCGGAGGCACATCCTGGCCATCCTGCAGGACTGCCCGTCCCTGCGGCCCCCCA
TCGACCACCTGTGTGAGCTGCTGCCGCGCCTGCAGGCCCGCTACTACTCCATCGCCTCATCCTCCAAGGT
CCACCCCAACTCTGTGCACATCTGTGCGGTGGTTGTGGAGTACGAGACCAAGGCCGGCCGCATCAACAAG
GGCGTGGCCACCAACTGGCTGCGGGCCAAGGAGCCTGTCGGGGAGAACGGCGGCCGTGCGCTGGTGCCCA
TGTTCGTGCGCAAGTCCCAGTTCCGCCTGCCCTTCAAGGCCACCACGCCTGTCATCATGGTGGGCCCCGG
CACCGGGGTGGCACCCTTCATAGGCTTCATCCAGGAGCGGGCCTGGCTGCGACAGCAGGGCAAGGAGGTG
GGGGAGACGCTGCTGTACTACGGCTGCCGCCGCTCGGATGAGGACTACCTGTACCGGGAGGAGCTGGCGC
AGTTCCACAGGGACGGTGCGCTCACCCAGCTCAACGTGGCCTTCTCCCGGGAGCAGTCCCACAAGGTCTA
CGTCCAGCACCTGCTAAAGCAAGACCGAGAGCACCTGTGGAAGTTGATCGAAGGCGGTGCCCACATCTAC
GTCTGTGGGGATGCACGGAACATGGCCAGGGATGTGCAGAACACCTTCTACGACATCGTGGCTGAGCTCG
GGGCCATGGAGCACGCGCAGGCGGTGGACTACATCAAGAAACTGATGACCAAGGGCCGCTACTCCCTGGA
CGTGTGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202172 representing NM_000941
Red=Cloning site Green=Tags(s)

MINMGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRES
SFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCM
ATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGD
DDGNLEEDFITWREQFWLAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFD
AKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMS
LNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYL
SWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINK
GVATNWLRAKEPVGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEV
GETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKLIEGGAHIY
VCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000941
ORF Size 2040 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000941.1, NM_000941.2, NP_000932
RefSeq Size 2509
RefSeq ORF 2043
Locus ID 5447
Cytogenetics 7q11.23
Domains flavodoxin, NAD_binding_1, FAD_binding_1
Protein Families Transmembrane, P450, Druggable Genome
MW 76.9 kDa
Gene Summary This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)