Cytochrome P450 Reductase (POR) (NM_000941) Human Tagged ORF Clone

CAT#: RC202172

Reviews ()
Write a review

POR (Myc-DDK-tagged)-Human P450 (cytochrome) oxidoreductase (POR)



Reconstitution Protocol

USD 623.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol POR
Synonyms CPR; CYPOR; P450R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202172 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAACATGGGAGACTCCCACGTGGACACCAGCTCCACCGTGTCCGAGGCGGTGGCCGAAGAAGTAT
CTCTTTTCAGCATGACGGACATGATTCTGTTTTCGCTCATCGTGGGTCTCCTAACCTACTGGTTCCTCTT
CAGAAAGAAAAAAGAAGAAGTCCCCGAGTTCACCAAAATTCAGACATTGACCTCCTCTGTCAGAGAGAGC
AGCTTTGTGGAAAAGATGAAGAAAACGGGGAGGAACATCATCGTGTTCTACGGCTCCCAGACGGGGACTG
CAGAGGAGTTTGCCAACCGCCTGTCCAAGGACGCCCACCGCTACGGGATGCGAGGCATGTCAGCGGACCC
TGAGGAGTATGACCTGGCCGACCTGAGCAGCCTGCCAGAGATCGACAACGCCCTGGTGGTTTTCTGCATG
GCCACCTACGGTGAGGGAGACCCCACCGACAATGCCCAGGACTTCTACGACTGGCTGCAGGAGACAGACG
TGGATCTCTCTGGGGTCAAGTTCGCGGTGTTTGGTCTTGGGAACAAGACCTACGAGCACTTCAATGCCAT
GGGCAAGTACGTGGACAAGCGGCTGGAGCAGCTCGGCGCCCAGCGCATCTTTGAGCTGGGGTTGGGCGAC
GACGATGGGAACTTGGAGGAGGACTTCATCACCTGGCGAGAGCAGTTCTGGCTGGCCGTGTGTGAACACT
TTGGGGTGGAAGCCACTGGCGAGGAGTCCAGCATTCGCCAGTACGAGCTTGTGGTCCACACCGACATAGA
TGCGGCCAAGGTGTACATGGGGGAGATGGGCCGGCTGAAGAGCTACGAGAACCAGAAGCCCCCCTTTGAT
GCCAAGAATCCGTTCCTGGCTGCAGTCACCACCAACCGGAAGCTGAACCAGGGAACCGAGCGCCACCTCA
TGCACCTGGAATTGGACATCTCGGACTCCAAAATCAGGTATGAATCTGGGGACCACGTGGCTGTGTACCC
AGCCAACGACTCTGCTCTCGTCAACCAGCTGGGCAAAATCCTGGGTGCCGACCTGGACGTCGTCATGTCC
CTGAACAACCTGGATGAGGAGTCCAACAAGAAGCACCCATTCCCGTGCCCTACGTCCTACCGCACGGCCC
TCACCTACTACCTGGACATCACCAACCCGCCGCGTACCAACGTGCTGTACGAGCTGGCGCAGTACGCCTC
GGAGCCCTCGGAGCAGGAGCTGCTGCGCAAGATGGCCTCCTCCTCCGGCGAGGGCAAGGAGCTGTACCTG
AGCTGGGTGGTGGAGGCCCGGAGGCACATCCTGGCCATCCTGCAGGACTGCCCGTCCCTGCGGCCCCCCA
TCGACCACCTGTGTGAGCTGCTGCCGCGCCTGCAGGCCCGCTACTACTCCATCGCCTCATCCTCCAAGGT
CCACCCCAACTCTGTGCACATCTGTGCGGTGGTTGTGGAGTACGAGACCAAGGCCGGCCGCATCAACAAG
GGCGTGGCCACCAACTGGCTGCGGGCCAAGGAGCCTGTCGGGGAGAACGGCGGCCGTGCGCTGGTGCCCA
TGTTCGTGCGCAAGTCCCAGTTCCGCCTGCCCTTCAAGGCCACCACGCCTGTCATCATGGTGGGCCCCGG
CACCGGGGTGGCACCCTTCATAGGCTTCATCCAGGAGCGGGCCTGGCTGCGACAGCAGGGCAAGGAGGTG
GGGGAGACGCTGCTGTACTACGGCTGCCGCCGCTCGGATGAGGACTACCTGTACCGGGAGGAGCTGGCGC
AGTTCCACAGGGACGGTGCGCTCACCCAGCTCAACGTGGCCTTCTCCCGGGAGCAGTCCCACAAGGTCTA
CGTCCAGCACCTGCTAAAGCAAGACCGAGAGCACCTGTGGAAGTTGATCGAAGGCGGTGCCCACATCTAC
GTCTGTGGGGATGCACGGAACATGGCCAGGGATGTGCAGAACACCTTCTACGACATCGTGGCTGAGCTCG
GGGCCATGGAGCACGCGCAGGCGGTGGACTACATCAAGAAACTGATGACCAAGGGCCGCTACTCCCTGGA
CGTGTGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202172 protein sequence
Red=Cloning site Green=Tags(s)

MINMGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRES
SFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCM
ATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGD
DDGNLEEDFITWREQFWLAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFD
AKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMS
LNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYL
SWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINK
GVATNWLRAKEPVGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEV
GETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKLIEGGAHIY
VCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000941
ORF Size 2040 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000941.1, NP_000932.1
RefSeq Size 2509 bp
RefSeq ORF 2043 bp
Locus ID 5447
UniProt ID P16435
Cytogenetics 7q11.23
Domains flavodoxin, NAD_binding_1, FAD_binding_1
Protein Families Druggable Genome, P450, Transmembrane
MW 77.1 kDa
Gene Summary This gene encodes an endoplasmic reticulum membrane oxidoreductase that is essential for multiple metabolic processes, including reactions catalyzed by cytochrome P450 proteins for metabolism of steroid hormones, drugs and xenobiotics. The encoded protein has a flavin adenine dinucleotide (FAD)-binding domain and a flavodoxin-like domain which bind two cofactors, FAD and FMN, that allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene cause a complex set of disorders, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome, that resemble those caused by defects in steroid metabolizing enzymes such as aromatase, 21-hydroxylase, and 17 alpha-hydroxylase. [provided by RefSeq, Aug 2020]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.