GCIP interacting protein p29 (SYF2) (NM_015484) Human Tagged ORF Clone

CAT#: RC202167

Reviews ()
Write a review

SYF2 (Myc-DDK-tagged)-Human SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1



  "NM_015484" in other vectors (5)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GCIP interacting protein p29 (SYF2) (NM_015484) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SYF2
Synonyms CBPIN; fSAP29; NTC31; P29
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC202167 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTATAGCTGCATCCGAGGTGCTGGTGGACAGCGCGGAGGAGGGGTCCCTCGCTGCGGCGGCGG
AGCTGGCCGCTCAGAAGCGCGAACAGAGACTGCGCAAATTCCGGGAGCTGCACCTGATGCGGAATGAAGC
TCGTAAATTAAATCACCAGGAAGTTGTGGAAGAAGATAAAAGACTAAAATTACCTGCAAATTGGGAAGCC
AAAAAAGCTCGTTTGGAGTGGGAACTAAAGGAAGAGGAAAAGAAAAAGGAATGTGCGGCAAGAGGAGAAG
ACTATGAGAAAGTGAAGTTGCTGGAGATCAGTGCAGAAGATGCAGAAAGATGGGAGAGGAAAAAGAAGAG
GAAAAACCCTGATCTGGGATTTTCAGATTATGCTGCTGCCCAGTTACGCCAGTATCATCGGTTGACCAAG
CAGATCAAACCTGACATGGAAACATATGAGAGACTGAGAGAAAAACATGGAGAAGAGTTTTTCCCAACAT
CCAATAGTCTTCTTCATGGAACACATGTGCCTTCCACAGAGGAAATTGACAGGATGGTCATAGATCTGGA
AAAACAGATTGAAAAACGAGACAAATATAGCCGGAGACGTCCTTATAATGATGATGCAGATATCGACTAC
ATTAATGAAAGGAATGCCAAATTCAACAAGAAAGCTGAAAGATTCTATGGGAAATACACAGCTGAAATTA
AACAGAATTTGGAAAGAGGAACAGCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202167 protein sequence
Red=Cloning site Green=Tags(s)

MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA
KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK
QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY
INERNAKFNKKAERFYGKYTAEIKQNLERGTAV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015484
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015484.5
RefSeq Size 1777 bp
RefSeq ORF 732 bp
Locus ID 25949
UniProt ID O95926
Cytogenetics 1p36.11
Protein Pathways Spliceosome
MW 28.7 kDa
Gene Summary This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "SYF2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


SYF2 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
    • 100 ul

USD 379.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 135.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools